Recombinant protein of human anti-Mullerian hormone (AMH)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Recombinant protein of human anti-Mullerian hormone (AMH)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
AMH (Myc-DDK-tagged)-Human anti-Mullerian hormone (AMH)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
AMH (untagged)-Human anti-Mullerian hormone (AMH)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF particles, AMH (Myc-DDK tagged) - Human anti-Mullerian hormone (AMH), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, AMH (mGFP-tagged) - Human anti-Mullerian hormone (AMH), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Purified recombinant protein of secreted human anti-Mullerian hormone (AMH), with C-terminal DDK/His tag, expressed in human cells, 20 µg
Tag | C-DDK/His |
Expression Host | HEK293 |
Lenti ORF clone of Human anti-Mullerian hormone (AMH), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, AMH (Myc-DDK tagged) - Human anti-Mullerian hormone (AMH), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human anti-Mullerian hormone (AMH), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, AMH (mGFP-tagged) - Human anti-Mullerian hormone (AMH), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
AMH (GFP-tagged) - Human anti-Mullerian hormone (AMH)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-AMH Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-AMH Antibody: synthetic peptide directed towards the middle region of human AMH. Synthetic peptide located within the following region: SVDLRAERSVLIPETYQANNCQGVCGWPQSDRNPRYGNHVVLLLKMQARG |
Lenti ORF clone of Human anti-Mullerian hormone (AMH), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
AMH HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
AMH (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 424-451 amino acids from the Central region of human AMH |
Transient overexpression lysate of anti-Mullerian hormone (AMH)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human anti-Mullerian hormone (AMH), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit anti-AMH polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide conjugated to KLH |
Purified recombinant protein of Human anti-Mullerian hormone (AMH), with C-terminal His tag, secretory expressed in CHO cells, 20ug
Tag | C-His |
Expression Host | CHO |
AMH MS Standard C13 and N15-labeled recombinant protein (NP_000470)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Anti-AMH Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 539-551 amino acids of human anti-Mullerian hormone |
Anti-AMH Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 539-551 amino acids of human anti-Mullerian hormone |
AMH Rabbit monoclonal antibody, clone OTIR1B8
AMH Rabbit monoclonal antibody, clone OTIR1B8
AMH Rabbit monoclonal antibody, clone OTIR1F8
AMH Rabbit monoclonal antibody, clone OTIR1F8
AMH Rabbit monoclonal antibody, clone OTIR5C9
AMH Rabbit monoclonal antibody, clone OTIR5C9
AMH Rabbit monoclonal antibody, clone OTIR1E3
AMH Rabbit monoclonal antibody, clone OTIR1E3
AMH Rabbit monoclonal antibody, clone OTIR2G3
AMH Rabbit monoclonal antibody, clone OTIR2G3
AMH Rabbit monoclonal antibody, clone OTIR2B5
AMH Rabbit monoclonal antibody, clone OTIR2B5
AMH Rabbit monoclonal antibody, clone OTIR3B3
AMH Rabbit monoclonal antibody, clone OTIR3B3
AMH Rabbit monoclonal antibody, clone OTIR3G5
AMH Rabbit monoclonal antibody, clone OTIR3G5
AMH Rabbit monoclonal antibody, clone OTIR4F7
AMH Rabbit monoclonal antibody, clone OTIR4F7
AMH Rabbit monoclonal antibody, clone OTIR4G8
AMH Rabbit monoclonal antibody, clone OTIR4G8
AMH Rabbit monoclonal antibody, clone OTIR1A3
AMH Rabbit monoclonal antibody, clone OTIR1A3
AMH Rabbit monoclonal antibody, clone OTIR5C11
AMH Rabbit monoclonal antibody, clone OTIR5C11
AMH Rabbit monoclonal antibody, clone OTIR5D9
AMH Rabbit monoclonal antibody, clone OTIR5D9
AMH Rabbit monoclonal antibody, clone OTIR2G3B5
AMH Rabbit monoclonal antibody, clone OTIR2G3B5