Products

cDNA Clones (15)
Proteins (8)
Antibodies (7)
Jump to Filters
View as table Download
BDKRB1 (NM_000710) Human Tagged ORF Clone
RC204436

USD 420.00

In Stock

BDKRB1 (Myc-DDK-tagged)-Human bradykinin receptor B1 (BDKRB1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
BDKRB1 (NM_000710) Human Tagged ORF Clone
RC228017

USD 420.00

In Stock

BDKRB1 (Myc-DDK-tagged)-Human bradykinin receptor B1 (BDKRB1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
BDKRB1 (NM_000710) Human Tagged ORF Clone
RG204436

USD 460.00

In Stock

BDKRB1 (GFP-tagged) - Human bradykinin receptor B1 (BDKRB1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
BDKRB1 (NM_000710) Human Tagged ORF Clone
RC204436L3

USD 620.00

3 Weeks

Lenti ORF clone of Human bradykinin receptor B1 (BDKRB1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
BDKRB1 (NM_000710) Human Tagged ORF Clone
RC228017L3

USD 620.00

3 Weeks

Lenti ORF clone of Human bradykinin receptor B1 (BDKRB1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
BDKRB1 (NM_000710) Human Tagged ORF Clone
RG228017

USD 460.00

3 Weeks

BDKRB1 (GFP-tagged) - Human bradykinin receptor B1 (BDKRB1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
BDKRB1 Rabbit Polyclonal Antibody
TA317579

USD 425.00

In Stock

B1R / BDKRB1 Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen B1R / BDKRB1 antibody was raised against synthetic 16 amino acid peptide from 1st cytoplasmic domain of human BDKRB1. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey (94%); Horse (81%).
BDKRB1 (NM_000710) Human Untagged Clone
SC122572

USD 310.00

In Stock

BDKRB1 (untagged)-Human bradykinin receptor B1 (BDKRB1)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
BDKRB1 Goat Polyclonal Antibody
TA302436

USD 375.00

In Stock

Goat Polyclonal Antibody against Bradykinin receptor B1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence KVWELYKQCTPK, from the internal region of the protein sequence according to NP_000701.2.
BDKRB1 (NM_000710) Human Tagged ORF Clone
RC204436L1

USD 768.00

In Stock

Lenti ORF clone of Human bradykinin receptor B1 (BDKRB1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
BDKRB1 Rabbit Polyclonal Antibody
TA311799

USD 345.00

In Stock

Rabbit polyclonal anti-BDKRB1 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human BDKRB1.
Modifications Phospho-specific
BDKRB1 Rabbit Polyclonal Antibody
TA317644

USD 425.00

In Stock

B1R / BDKRB1 Rabbit Polyclonal (Extracellular Domain) Antibody

Applications IHC
Reactivities Human, Monkey, Gorilla
Conjugation Unconjugated
Immunogen B1R / BDKRB1 antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human BDKRB1. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon (94%); Rat, Hamster (89%); Mouse, Rabbit, Horse (83%).
BDKRB1 (NM_000710) Human Over-expression Lysate
LC400238

USD 121.00

2 Weeks

BDKRB1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
BDKRB1 (NM_000710) Human Tagged ORF Clone
RC204436L2

USD 620.00

3 Weeks

Lenti ORF clone of Human bradykinin receptor B1 (BDKRB1), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
BDKRB1 Rabbit Polyclonal Antibody
TA338374

USD 375.00

5 Days

Rabbit Polyclonal Anti-BDKRB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BDKRB1 antibody is: synthetic peptide directed towards the C-terminal region of Human BDKRB1. Synthetic peptide located within the following region: RTREEVSRTRCGGRKDSKTTALILTLVVAFLVCWAPYHFFAFLEFLFQVQ
BDKRB1 (Center) Rabbit Polyclonal Antibody
AP17901PU-N

USD 450.00

2 Weeks

BDKRB1 (Center) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the Center region of human BDKRB1
BDKRB1 Rabbit Polyclonal Antibody
TA358861

USD 360.00

5 Days

BDKRB1 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
BDKRB1 ICC Control Block
TB404436

USD 1,070.00

4 Weeks

Transient overexpression of BDKRB1 (NM_000710) in HEK293T cells paraffin embedded controls for ICC/IHC staining

BDKRB1 ICC Control Block
TB428017

USD 1,070.00

4 Weeks

Transient overexpression of BDKRB1 (NM_000710) in HEK293T cells paraffin embedded controls for ICC/IHC staining

BDKRB1 Cytosection
TS404436

USD 225.00

4 Weeks

Transient overexpression of BDKRB1 (NM_000710) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

BDKRB1 Cytosection
TS404436P5

USD 889.00

4 Weeks

Transient overexpression of BDKRB1 (NM_000710) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

BDKRB1 Cytosection
TS428017

USD 225.00

4 Weeks

Transient overexpression of BDKRB1 (NM_000710) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

BDKRB1 Cytosection
TS428017P5

USD 889.00

4 Weeks

Transient overexpression of BDKRB1 (NM_000710) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack