Products

Proteins (11)
cDNA Clones (11)
Antibodies (1)
Jump to Filters
View as table Download
C8 (C8G) (NM_000606) Human Tagged ORF Clone
RC222236

USD 420.00

In Stock

C8G (Myc-DDK-tagged)-Human complement component 8, gamma polypeptide (C8G)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
C8 (C8G) (NM_000606) Human Tagged ORF Clone Lentiviral Particle
RC222236L2V

USD 820.00

3 Weeks

Lenti ORF particles, C8G (mGFP-tagged) - Human complement component 8, gamma polypeptide (C8G), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
C8 (C8G) (NM_000606) Human Tagged ORF Clone
RC222236L3

USD 620.00

3 Weeks

Lenti ORF clone of Human complement component 8, gamma polypeptide (C8G), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
C8 (C8G) (NM_000606) Human Tagged ORF Clone
RC222236L4

USD 620.00

3 Weeks

Lenti ORF clone of Human complement component 8, gamma polypeptide (C8G), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
C8 (C8G) (NM_000606) Human Tagged ORF Clone Lentiviral Particle
RC222236L4V

USD 820.00

6 Weeks

Lenti ORF particles, C8G (mGFP-tagged) - Human complement component 8, gamma polypeptide (C8G), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
C8 (C8G) (NM_000606) Human Tagged ORF Clone
RG222236

USD 460.00

3 Weeks

C8G (GFP-tagged) - Human complement component 8, gamma polypeptide (C8G)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
C8 (C8G) (NM_000606) Human Tagged ORF Clone
RC222236L2

USD 620.00

In Stock

Lenti ORF clone of Human complement component 8, gamma polypeptide (C8G), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
C8 (C8G) Rabbit Polyclonal Antibody
TA346208

USD 475.00

5 Days

Rabbit Polyclonal Anti-C8G Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-C8G antibody is: synthetic peptide directed towards the N-terminal region of Human C8G. Synthetic peptide located within the following region: VGSACRFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGD
C8 (C8G) (NM_000606) Human Tagged ORF Clone
RC222236L1

USD 620.00

3 Weeks

Lenti ORF clone of Human complement component 8, gamma polypeptide (C8G), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Complement C8G (21-202, His-tag) Human Protein
AR50060PU-N

USD 845.00

2 Weeks

Complement C8G (21-202, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
Complement C8G (21-202, His-tag) Human Protein
AR50060PU-S

USD 330.00

2 Weeks

Complement C8G (21-202, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
C8 (C8G) (NM_000606) Human Over-expression Lysate
LC424611

USD 121.00

2 Weeks

C8G HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
C8 (C8G) (NM_000606) Human Untagged Clone
SC300107

USD 420.00

3 Weeks

C8G (untagged)-Human complement component 8, gamma polypeptide (C8G)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
C8 (C8G) ICC Control Block
TB422236

USD 1,070.00

4 Weeks

Transient overexpression of C8G (NM_000606) in HEK293T cells paraffin embedded controls for ICC/IHC staining

C8 (C8G) (NM_000606) Human Recombinant Protein
TP721176

USD 330.00

3 Weeks

Purified recombinant protein of Human complement component 8, gamma polypeptide (C8G)

Tag N-His
Expression Host E. coli
C8 (C8G) (NM_000606) Human Recombinant Protein
TP721176L

USD 1,900.00

3 Weeks

Purified recombinant protein of Human complement component 8, gamma polypeptide (C8G)

Tag N-His
Expression Host E. coli
C8 (C8G) (NM_000606) Human Recombinant Protein
TP721176M

USD 760.00

3 Weeks

Purified recombinant protein of Human complement component 8, gamma polypeptide (C8G)

Tag N-His
Expression Host E. coli
C8 (C8G) (NM_000606) Human Recombinant Protein
TP721176XL

USD 2,800.00

3 Weeks

Purified recombinant protein of Human complement component 8, gamma polypeptide (C8G)

Tag N-His
Expression Host E. coli
C8 (C8G) Cytosection
TS422236

USD 225.00

4 Weeks

Transient overexpression of C8G (NM_000606) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

C8 (C8G) Cytosection
TS422236P5

USD 889.00

4 Weeks

Transient overexpression of C8G (NM_000606) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack