Products

View as table Download

CARD9 (Myc-DDK-tagged)-Human caspase recruitment domain family, member 9 (CARD9), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, CARD9 (mGFP-tagged) - Human caspase recruitment domain family, member 9 (CARD9), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

CARD9 (Myc-DDK-tagged)-Human caspase recruitment domain family, member 9 (CARD9), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Recombinant protein of human caspase recruitment domain family, member 9 (CARD9), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T

CARD9 (GFP-tagged) - Human caspase recruitment domain family, member 9 (CARD9), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF particles, CARD9 (Myc-DDK tagged) - Human caspase recruitment domain family, member 9 (CARD9), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, CARD9 (mGFP-tagged) - Human caspase recruitment domain family, member 9 (CARD9), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

Lenti ORF particles, CARD9 (Myc-DDK tagged) - Human caspase recruitment domain family, member 9 (CARD9), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, CARD9 (mGFP-tagged) - Human caspase recruitment domain family, member 9 (CARD9), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

Lenti ORF clone of Human caspase recruitment domain family, member 9 (CARD9), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CARD9 (Myc-DDK tagged) - Human caspase recruitment domain family, member 9 (CARD9), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human caspase recruitment domain family, member 9 (CARD9), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human caspase recruitment domain family, member 9 (CARD9), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CARD9 (Myc-DDK tagged) - Human caspase recruitment domain family, member 9 (CARD9), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human caspase recruitment domain family, member 9 (CARD9), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CARD9 (mGFP-tagged) - Human caspase recruitment domain family, member 9 (CARD9), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

CARD9 (GFP-tagged) - Human caspase recruitment domain family, member 9 (CARD9), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human caspase recruitment domain family, member 9 (CARD9), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

CARD9 (untagged)-Human caspase recruitment domain family, member 9 (CARD9), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

Lenti ORF clone of Human caspase recruitment domain family, member 9 (CARD9), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Rabbit Polyclonal Anti-CARD9 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CARD9 antibody: synthetic peptide directed towards the middle region of human CARD9. Synthetic peptide located within the following region: ALHQEQVLRNPHDAGLSSGEPPEKERRRLKESFENYRRKRALRKMQKGWR

Lenti ORF clone of Human caspase recruitment domain family, member 9 (CARD9), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human caspase recruitment domain family, member 9 (CARD9), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

CARD9 (untagged)-Human caspase recruitment domain family, member 9 (CARD9), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

CARD9 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Rabbit Polyclonal CARD9 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen CARD9 antibody was raised against a synthetic peptide corresponding to amino acids 521 to 536 of human CARD9 The sequence is different from that of rat origin by two amino acids.

Carrier-free (BSA/glycerol-free) CARD9 mouse monoclonal antibody,clone OTI3F8

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

CARD9 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

CARD9 MS Standard C13 and N15-labeled recombinant protein (NP_434700)

Tag C-Myc/DDK
Expression Host HEK293

CARD9 MS Standard C13 and N15-labeled recombinant protein (NP_434701)

Tag C-Myc/DDK
Expression Host HEK293

Rabbit Polyclonal Anti-CARD9 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CARD9

CARD9 mouse monoclonal antibody,clone OTI3F8

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

CARD9 mouse monoclonal antibody,clone OTI3F8, Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

CARD9 mouse monoclonal antibody,clone OTI3F8, HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

CARD9 mouse monoclonal antibody,clone OTI3F8

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Transient overexpression of CARD9 (NM_052813) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of CARD9 (NM_052814) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of CARD9 (NM_052813) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of CARD9 (NM_052813) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

USD 225.00

4 Weeks

Transient overexpression of CARD9 (NM_052814) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of CARD9 (NM_052814) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack