CARD9 Rabbit Polyclonal Antibody
USD 867.00
USD 495.00
USD 159.00
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-CARD9 antibody: synthetic peptide directed towards the middle region of human CARD9. Synthetic peptide located within the following region: ALHQEQVLRNPHDAGLSSGEPPEKERRRLKESFENYRRKRALRKMQKGWR |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 62 kDa |
Gene Name | caspase recruitment domain family member 9 |
Database Link | |
Background | The protein encoded by this gene is a member of the CARD protein family, which is defined by the presence of a characteristic caspase-associated recruitment domain (CARD). CARD is a protein interaction domain known to participate in activation or suppression of CARD containing members of the caspase family, and thus plays an important regulatory role in cell apoptosis. This protein was identified by its selective association with the CARD domain of BCL10, a postive regulator of apoptosis and NF-kappaB activation, and is thought to function as a molecular scaffold for the assembly of a BCL10 signaling complex that activates NF-kappaB. Several alternatively spliced transcript variants have been observed, but their full-length nature is not clearly defined. |
Synonyms | CANDF2; hCARD9 |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 92%; Mouse: 90%; Horse: 86% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | NOD-like receptor signaling pathway |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
Be the first one to submit a review