Products

View as table Download

Recombinant protein of human carboxylesterase 7 (CES7), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T

CES5A (Myc-DDK-tagged)-Human carboxylesterase 5A (CES5A), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF particles, CES5A (Myc-DDK tagged) - Human carboxylesterase 5A (CES5A), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CES5A (mGFP-tagged) - Human carboxylesterase 5A (CES5A), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

CES5A (Myc-DDK-tagged)-Human carboxylesterase 5A (CES5A), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF particles, CES5A (Myc-DDK-tagged)-Human carboxylesterase 5A (CES5A), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CES5A (mGFP-tagged)-Human carboxylesterase 5A (CES5A), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CES5A (Myc-DDK-tagged)-Human carboxylesterase 5A (CES5A), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CES5A (mGFP-tagged)-Human carboxylesterase 5A (CES5A), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

CES5A (GFP-tagged) - Human carboxylesterase 5A (CES5A), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

CES5A (GFP-tagged) - Human carboxylesterase 5A (CES5A), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

CES5A (GFP-tagged) - Human carboxylesterase 5A (CES5A), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human carboxylesterase 5A (CES5A), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

CES5A (untagged)-Human carboxylesterase 5A (CES5A), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Carboxylesterase 7 (CES5A) (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the Center region of human CES7

Rabbit Polyclonal Anti-CES5A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CES7 antibody: synthetic peptide directed towards the N terminal of human CES7. Synthetic peptide located within the following region: SGNWVHPGQILIWAIWVLAAPTKGPSAEGPQRNTRLGWIQGKQVTVLGSP

Rabbit Polyclonal Anti-CES5A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CES7 antibody: synthetic peptide directed towards the middle region of human CES7. Synthetic peptide located within the following region: LTEIRDSLLDLLGDVFFVVPALITARYHREGATEEEKLLSRKMMKYWATF

CES5A HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

CES7 MS Standard C13 and N15-labeled recombinant protein (NP_659461)

Tag C-Myc/DDK
Expression Host HEK293

Transient overexpression of CES5A (NM_145024) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of CES5A (NM_001143685) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of CES5A (NM_001190158) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of CES5A (NM_145024) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of CES5A (NM_145024) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of CES5A (NM_001143685) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of CES5A (NM_001190158) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of CES5A (NM_001190158) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack