Products

Antibodies (40)
cDNA Clones (15)
Proteins (14)
Jump to Filters
View as table Download
Placental lactogen (CSH1) (NM_022640) Human Tagged ORF Clone
RC223244

USD 420.00

In Stock

CSH1 (Myc-DDK-tagged)-Human chorionic somatomammotropin hormone 1 (placental lactogen) (CSH1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Placental lactogen (CSH1) (NM_001317) Human Tagged ORF Clone
RG215860

USD 460.00

In Stock

CSH1 (GFP-tagged) - Human chorionic somatomammotropin hormone 1 (placental lactogen) (CSH1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Placental lactogen (CSH1) (NM_022640) Human Tagged ORF Clone
RG223244

USD 460.00

In Stock

CSH1 (GFP-tagged) - Human chorionic somatomammotropin hormone 1 (placental lactogen) (CSH1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Placental lactogen (CSH1) (NM_001317) Human Tagged ORF Clone Lentiviral Particle
RC215860L3V

USD 820.00

6 Weeks

Lenti ORF particles, CSH1 (Myc-DDK tagged) - Human chorionic somatomammotropin hormone 1 (placental lactogen) (CSH1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Placental lactogen (CSH1) (NM_001317) Human Tagged ORF Clone
RC215860L4

USD 620.00

3 Weeks

Lenti ORF clone of Human chorionic somatomammotropin hormone 1 (placental lactogen) (CSH1), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Placental lactogen (CSH1) (NM_001317) Human Tagged ORF Clone Lentiviral Particle
RC215860L4V

USD 820.00

6 Weeks

Lenti ORF particles, CSH1 (mGFP-tagged) - Human chorionic somatomammotropin hormone 1 (placental lactogen) (CSH1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Placental lactogen (CSH1) (NM_022640) Human Tagged ORF Clone
RC223244L3

USD 620.00

3 Weeks

Lenti ORF clone of Human chorionic somatomammotropin hormone 1 (placental lactogen) (CSH1), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Placental lactogen (CSH1) (NM_022640) Human Tagged ORF Clone Lentiviral Particle
RC223244L3V

USD 820.00

6 Weeks

Lenti ORF particles, CSH1 (Myc-DDK tagged) - Human chorionic somatomammotropin hormone 1 (placental lactogen) (CSH1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Placental lactogen (CSH1) (NM_022640) Human Tagged ORF Clone
RC223244L4

USD 620.00

3 Weeks

Lenti ORF clone of Human chorionic somatomammotropin hormone 1 (placental lactogen) (CSH1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Placental lactogen (CSH1) (NM_022640) Human Tagged ORF Clone Lentiviral Particle
RC223244L4V

USD 820.00

6 Weeks

Lenti ORF particles, CSH1 (mGFP-tagged) - Human chorionic somatomammotropin hormone 1 (placental lactogen) (CSH1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Placental lactogen (CSH1) Rabbit Polyclonal Antibody
TA345768

USD 410.00

5 Days

Rabbit Polyclonal Anti-CSH1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CSH1 antibody: synthetic peptide directed towards the middle region of human CSH1. Synthetic peptide located within the following region: SMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYS
Placental lactogen (CSH1) Rabbit Polyclonal Antibody
TA590463

USD 409.00

In Stock

Rabbit Polyclonal Placental Lactogen Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
Placental lactogen (CSH1) (NM_001317) Human Untagged Clone
SC119301

USD 310.00

In Stock

CSH1 (untagged)-Human chorionic somatomammotropin hormone 1 (placental lactogen) (CSH1)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
Placental lactogen (CSH1) (NM_022641) Human Untagged Clone
SC109120

USD 420.00

In Stock

CSH1 (untagged)-Human chorionic somatomammotropin hormone 1 (placental lactogen) (CSH1), transcript variant 3

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
Placental lactogen (CSH1) (NM_022640) Human Untagged Clone
SC112456

USD 420.00

In Stock

CSH1 (untagged)-Human chorionic somatomammotropin hormone 1 (placental lactogen) (CSH1), transcript variant 2

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
Placental lactogen (CSH1) (C-term) Rabbit Polyclonal Antibody
AP51099PU-N

USD 450.00

2 Weeks

Placental lactogen (CSH1) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 180-208 amino acids from the C-terminal region of human CSH1
Placental lactogen (CSH1) (NM_022640) Human Over-expression Lysate
LC411615

USD 121.00

In Stock

CSH1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Placental lactogen (CSH1) (NM_001317) Human Over-expression Lysate
LC420012

USD 121.00

In Stock

CSH1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Placental lactogen (CSH1) (NM_022640) Human Over-expression Lysate
LY411615

USD 396.00

In Stock

Transient overexpression lysate of chorionic somatomammotropin hormone 1 (placental lactogen) (CSH1), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Placental lactogen (CSH1) (NM_001317) Human Over-expression Lysate
LY420012

USD 396.00

In Stock

Transient overexpression lysate of chorionic somatomammotropin hormone 1 (placental lactogen) (CSH1), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Placental lactogen (CSH1) Mouse Monoclonal Antibody [Clone ID: OTI2G4]
CF506708

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CSH1 mouse monoclonal antibody, clone OTI2G4 (formerly 2G4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Placental lactogen (CSH1) (NM_001317) Human Mass Spec Standard
PH315860

USD 2,055.00

3 Weeks

CSH1 MS Standard C13 and N15-labeled recombinant protein (NP_001308)

Tag C-Myc/DDK
Expression Host HEK293
Placental lactogen (CSH1) Rabbit Polyclonal Antibody
TA327692

USD 380.00

5 Days

Rabbit Polyclonal hPL Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Placental lactogen (CSH1) Rabbit Polyclonal Antibody
TA350056

USD 345.00

In Stock

Rabbit Polyclonal Anti-CSH1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CSH1
Placental lactogen (CSH1) Mouse Monoclonal Antibody [Clone ID: OTI2G4]
TA506708

USD 379.00

In Stock

CSH1 mouse monoclonal antibody, clone OTI2G4 (formerly 2G4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Placental lactogen (CSH1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2G4]
TA506708AM

USD 420.00

4 Weeks

CSH1 mouse monoclonal antibody, clone OTI2G4 (formerly 2G4), Biotinylated

Applications IHC, WB
Reactivities Human
Conjugation Biotin
Placental lactogen (CSH1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2G4]
TA506708BM

USD 420.00

4 Weeks

CSH1 mouse monoclonal antibody, clone OTI2G4 (formerly 2G4), HRP conjugated

Applications IHC, WB
Reactivities Human
Conjugation HRP
Placental lactogen (CSH1) Mouse Monoclonal Antibody [Clone ID: OTI2G4]
TA506708S

USD 159.00

2 Days

CSH1 mouse monoclonal antibody, clone OTI2G4 (formerly 2G4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated