Products

Proteins (14)
cDNA Clones (14)
Antibodies (2)
Jump to Filters
View as table Download
CTDSPL (NM_001008392) Human Tagged ORF Clone
RC223937

USD 420.00

In Stock

CTDSPL (Myc-DDK-tagged)-Human CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase-like (CTDSPL), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CTDSPL (NM_005808) Human Tagged ORF Clone
RC214440

USD 98.00

USD 390.00

In Stock

CTDSPL (Myc-DDK-tagged)-Human CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase-like (CTDSPL), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CTDSPL (NM_005808) Human Tagged ORF Clone
RG214440

USD 460.00

In Stock

CTDSPL (GFP-tagged) - Human CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase-like (CTDSPL), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CTDSPL (NM_001008392) Human Tagged ORF Clone
RG223937

USD 460.00

In Stock

CTDSPL (GFP-tagged) - Human CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase-like (CTDSPL), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CTDSPL (NM_005808) Human Tagged ORF Clone
RC214440L3

USD 620.00

3 Weeks

Lenti ORF clone of Human CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase-like (CTDSPL), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CTDSPL (NM_005808) Human Tagged ORF Clone Lentiviral Particle
RC214440L3V

USD 820.00

6 Weeks

Lenti ORF particles, CTDSPL (Myc-DDK tagged) - Human CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase-like (CTDSPL), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CTDSPL (NM_005808) Human Tagged ORF Clone
RC214440L4

USD 620.00

3 Weeks

Lenti ORF clone of Human CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase-like (CTDSPL), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CTDSPL (NM_005808) Human Tagged ORF Clone Lentiviral Particle
RC214440L4V

USD 820.00

6 Weeks

Lenti ORF particles, CTDSPL (mGFP-tagged) - Human CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase-like (CTDSPL), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CTDSPL (NM_001008392) Human Tagged ORF Clone
RC223937L3

USD 620.00

3 Weeks

Lenti ORF clone of Human CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase-like (CTDSPL), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CTDSPL (NM_001008392) Human Tagged ORF Clone Lentiviral Particle
RC223937L3V

USD 820.00

6 Weeks

Lenti ORF particles, CTDSPL (Myc-DDK tagged) - Human CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase-like (CTDSPL), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CTDSPL (NM_001008392) Human Tagged ORF Clone
RC223937L4

USD 620.00

3 Weeks

Lenti ORF clone of Human CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase-like (CTDSPL), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CTDSPL (NM_001008392) Human Tagged ORF Clone Lentiviral Particle
RC223937L4V

USD 820.00

6 Weeks

Lenti ORF particles, CTDSPL (mGFP-tagged) - Human CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase-like (CTDSPL), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CTDSPL Rabbit Polyclonal Antibody
TA346421

USD 475.00

5 Days

Rabbit Polyclonal Anti-CTDSPL Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CTDSPL antibody: synthetic peptide directed towards the N terminal of human CTDSPL. Synthetic peptide located within the following region: CCFRDYNVEAPPPSSPSVLPPLVEENGGLQKPPAKYLLPEVTVLDYGKKC
CTDSPL (N-term) Rabbit Polyclonal Antibody
AP51119PU-N

USD 450.00

2 Weeks

CTDSPL (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 4-34 amino acids from the N-terminal region of Human CTDSPL.
CTDSPL (NM_001008392) Human Untagged Clone
SC128019

USD 660.00

In Stock

CTDSPL (untagged)-Human CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase-like (CTDSPL), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
CTDSPL (NM_005808) Human Untagged Clone
SC128039

USD 420.00

In Stock

CTDSPL (untagged)-Human CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase-like (CTDSPL), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
CTDSPL (NM_001008392) Human Recombinant Protein
TP760411

USD 215.00

In Stock

Purified recombinant protein of Human CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase-like (CTDSPL), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli
CTDSPL (82-265, His-tag) Human Protein
AR50233PU-N

USD 845.00

2 Weeks

CTDSPL (82-265, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
CTDSPL (82-265, His-tag) Human Protein
AR50233PU-S

USD 330.00

2 Weeks

CTDSPL (82-265, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
CTDSPL (NM_005808) Human Over-expression Lysate
LC401765

USD 121.00

2 Weeks

CTDSPL HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
CTDSPL (NM_001008392) Human Over-expression Lysate
LC423419

USD 121.00

2 Weeks

CTDSPL HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CTDSPL (NM_005808) Human Over-expression Lysate
LY401765

USD 396.00

5 Days

Transient overexpression lysate of CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase-like (CTDSPL), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CTDSPL (NM_001008392) Human Over-expression Lysate
LY423419

USD 396.00

5 Days

Transient overexpression lysate of CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase-like (CTDSPL), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CTDSPL (NM_005808) Human Mass Spec Standard
PH314440

USD 2,055.00

3 Weeks

CTDSPL MS Standard C13 and N15-labeled recombinant protein (NP_005799)

Tag C-Myc/DDK
Expression Host HEK293
CTDSPL (NM_005808) ICC Control Block
TB414440

USD 1,040.00

4 Weeks

Transient overexpression of CTDSPL (NM_005808) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CTDSPL (NM_001008392) ICC Control Block
TB423937

USD 1,070.00

4 Weeks

Transient overexpression of CTDSPL (NM_001008392) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CTDSPL Cytosection
TS414440

USD 225.00

4 Weeks

Transient overexpression of CTDSPL (NM_005808) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

CTDSPL Cytosection
TS414440P5

USD 889.00

4 Weeks

Transient overexpression of CTDSPL (NM_005808) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

CTDSPL Cytosection
TS423937

USD 225.00

4 Weeks

Transient overexpression of CTDSPL (NM_001008392) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

CTDSPL Cytosection
TS423937P5

USD 889.00

4 Weeks

Transient overexpression of CTDSPL (NM_001008392) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack