Germany
Japan
United Kingdom
China
CYBA (Myc-DDK-tagged)-Human cytochrome b-245, alpha polypeptide (CYBA)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, CYBA (Myc-DDK tagged) - Human cytochrome b-245, alpha polypeptide (CYBA), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, CYBA (mGFP-tagged) - Human cytochrome b-245, alpha polypeptide (CYBA), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
CYBA (GFP-tagged) - Human cytochrome b-245, alpha polypeptide (CYBA)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human cytochrome b-245, alpha polypeptide (CYBA), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CYBA (Myc-DDK tagged) - Human cytochrome b-245, alpha polypeptide (CYBA), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, CYBA (mGFP-tagged) - Human cytochrome b-245, alpha polypeptide (CYBA), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
CYBA (untagged)-Human cytochrome b-245, alpha polypeptide (CYBA)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human cytochrome b-245, alpha polypeptide (CYBA), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human cytochrome b-245, alpha polypeptide (CYBA), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Transient overexpression lysate of cytochrome b-245, alpha polypeptide (CYBA)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Lenti ORF clone of Human cytochrome b-245, alpha polypeptide (CYBA), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Anti-CYBA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYBA antibody: synthetic peptide directed towards the middle region of human CYBA. Synthetic peptide located within the following region: TILGTACLAIASGIYLLAAVRGEQWTPIEPKPRERPQIGGTIKQPPSNPP |
CYBA HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
(untagged)-Homo sapiens, similar to putative, clone MGC:39995 IMAGE:5217162, complete cds
| Vector | pCMV6 series |
| Tag | Tag Free |
Transient overexpression of CYBA (NM_000101) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CYBA (NM_000101) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CYBA (NM_000101) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- CYBA
Families
- Druggable Genome