Products

cDNA Clones (17)
Proteins (11)
Antibodies (2)
Jump to Filters
View as table Download
CDT2 (DTL) (NM_016448) Human Tagged ORF Clone
RC207280

USD 610.00

In Stock

DTL (Myc-DDK-tagged)-Human denticleless homolog (Drosophila) (DTL)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CDT2 (DTL) (NM_016448) Human Tagged ORF Clone
RG207280

USD 670.00

In Stock

DTL (GFP-tagged) - Human denticleless homolog (Drosophila) (DTL)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CDT2 (DTL) (NM_016448) Human Tagged ORF Clone
RC207280L3

USD 810.00

3 Weeks

Lenti ORF clone of Human denticleless homolog (Drosophila) (DTL), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CDT2 (DTL) (NM_016448) Human Tagged ORF Clone
RC207280L4

USD 810.00

3 Weeks

Lenti ORF clone of Human denticleless homolog (Drosophila) (DTL), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CDT2 (DTL) (NM_001286229) Human Tagged ORF Clone
RC238348

USD 480.00

2 Weeks

DTL (myc-DDK-tagged) - Human denticleless E3 ubiquitin protein ligase homolog (Drosophila) (DTL), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CDT2 (DTL) (NM_001286230) Human Tagged ORF Clone
RC239313

USD 610.00

3 Weeks

DTL (myc-DDK-tagged) - Human denticleless E3 ubiquitin protein ligase homolog (Drosophila) (DTL), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CDT2 (DTL) (NM_016448) Human Untagged Clone
SC114271

USD 310.00

In Stock

DTL (untagged)-Human denticleless homolog (Drosophila) (DTL)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
CDT2 (DTL) (NM_016448) Human Tagged ORF Clone
RC207280L1

USD 1,008.00

In Stock

Lenti ORF clone of Human denticleless homolog (Drosophila) (DTL), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
CDT2 (DTL) (NM_016448) Human Tagged ORF Clone
RC207280L2

USD 810.00

3 Weeks

Lenti ORF clone of Human denticleless homolog (Drosophila) (DTL), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
CDT2 (DTL) (NM_016448) Human Recombinant Protein
TP761146

USD 215.00

In Stock

Purified recombinant protein of Human denticleless homolog (Drosophila) (DTL), full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug

Tag N-GST and C-His
Expression Host E. coli
CDT2 (DTL) (Center) Rabbit Polyclonal Antibody
AP51328PU-N

USD 450.00

2 Weeks

CDT2 (DTL) (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 229-256 amino acids from the Central region of Human DTL.
CDT2 (DTL) (NM_016448) Human Over-expression Lysate
LY402552

USD 396.00

5 Days

Transient overexpression lysate of denticleless homolog (Drosophila) (DTL)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CDT2 (DTL) Rabbit Polyclonal Antibody
TA339337

USD 375.00

5 Days

Rabbit Polyclonal Anti-DTL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DTL antibody: synthetic peptide directed towards the N terminal of human DTL. Synthetic peptide located within the following region: VNQISGAHNTSDKQTPSKPKKKQNSKGLAPSVDFQQSVTVVLFQDENTLV
CDT2 (DTL) (NM_016448) Human Over-expression Lysate
LC402552

USD 121.00

2 Weeks

DTL HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CDT2 (DTL) (NM_001286229) Human Tagged ORF Clone
RG238348

USD 520.00

2 Weeks

DTL (GFP-tagged) - Human denticleless E3 ubiquitin protein ligase homolog (Drosophila) (DTL), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CDT2 (DTL) (NM_001286230) Human Tagged ORF Clone
RG239313

USD 650.00

2 Weeks

DTL (GFP-tagged) - Human denticleless E3 ubiquitin protein ligase homolog (Drosophila) (DTL), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CDT2 (DTL) (NM_001286229) Human Untagged Clone
SC336242

USD 460.00

2 Weeks

DTL (untagged) - Human denticleless E3 ubiquitin protein ligase homolog (Drosophila) (DTL), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
CDT2 (DTL) (NM_001286230) Human Untagged Clone
SC337207

USD 700.00

3 Weeks

DTL (untagged) - Human denticleless E3 ubiquitin protein ligase homolog (Drosophila) (DTL), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
CDT2 (DTL) (NM_016448) ICC Control Block
TB407280

USD 1,260.00

4 Weeks

Transient overexpression of DTL (NM_016448) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CDT2 (DTL) (NM_001286229) ICC Control Block
TB438348

USD 1,130.00

4 Weeks

Transient overexpression of DTL (NM_001286229) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CDT2 (DTL) (NM_001286230) ICC Control Block
TB439313

USD 1,260.00

4 Weeks

Transient overexpression of DTL (NM_001286230) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CDT2 (DTL) Cytosection
TS407280

USD 225.00

4 Weeks

Transient overexpression of DTL (NM_016448) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

CDT2 (DTL) Cytosection
TS407280P5

USD 889.00

4 Weeks

Transient overexpression of DTL (NM_016448) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

CDT2 (DTL) ICC Control Sections
TS438348P5

USD 889.00

4 Weeks

Transient overexpression of DTL (NM_001286229) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

CDT2 (DTL) ICC Control Sections
TS439313P5

USD 889.00

4 Weeks

Transient overexpression of DTL (NM_001286230) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack