Germany
Japan
United Kingdom
China
DTL (Myc-DDK-tagged)-Human denticleless homolog (Drosophila) (DTL)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Purified recombinant protein of Homo sapiens denticleless homolog (Drosophila) (DTL)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, DTL (Myc-DDK tagged) - Human denticleless homolog (Drosophila) (DTL), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, DTL (mGFP-tagged) - Human denticleless homolog (Drosophila) (DTL), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Dtl (Myc-DDK-tagged) - Mouse denticleless homolog (Drosophila) (Dtl)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
DTL (GFP-tagged) - Human denticleless homolog (Drosophila) (DTL)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
DTL - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN407280 is the updated version of KN207280.
Dtl - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN504841 is the updated version of KN304841.
Dtl (GFP-tagged) - Mouse denticleless homolog (Drosophila) (Dtl), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Dtl (Myc-DDK-tagged) - Mouse denticleless homolog (Drosophila) (Dtl)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Dtl (Myc-DDK-tagged) - Mouse denticleless homolog (Drosophila) (Dtl), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Dtl (mGFP-tagged) - Mouse denticleless homolog (Drosophila) (Dtl)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Dtl (GFP-tagged) - Mouse denticleless homolog (Drosophila) (Dtl), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human denticleless homolog (Drosophila) (DTL), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, DTL (Myc-DDK tagged) - Human denticleless homolog (Drosophila) (DTL), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human denticleless homolog (Drosophila) (DTL), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, DTL (mGFP-tagged) - Human denticleless homolog (Drosophila) (DTL), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
DTL (myc-DDK-tagged) - Human denticleless E3 ubiquitin protein ligase homolog (Drosophila) (DTL), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
DTL (myc-DDK-tagged) - Human denticleless E3 ubiquitin protein ligase homolog (Drosophila) (DTL), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
DTL (untagged)-Human denticleless homolog (Drosophila) (DTL)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human denticleless homolog (Drosophila) (DTL), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
DTL - Human, 4 unique 29mer shRNA constructs in retroviral GFP vector
| Format | Retroviral plasmids |
| Vector | pGFP-V-RS |
Lenti ORF clone of Human denticleless homolog (Drosophila) (DTL), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
DTL - Human, 4 unique 29mer shRNA constructs in retroviral RFP vector
| Format | Retroviral plasmids |
| Vector | pRFP-C-RS |
Purified recombinant protein of Human denticleless homolog (Drosophila) (DTL), full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug
| Tag | N-GST and C-His |
| Expression Host | E. coli |
DTL - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Transient overexpression lysate of denticleless homolog (Drosophila) (DTL)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
DTL - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | GFP-puro |
Rabbit Polyclonal Anti-DTL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DTL antibody: synthetic peptide directed towards the N terminal of human DTL. Synthetic peptide located within the following region: VNQISGAHNTSDKQTPSKPKKKQNSKGLAPSVDFQQSVTVVLFQDENTLV |
DTL CRISPRa kit - CRISPR gene activation of human denticleless E3 ubiquitin protein ligase homolog
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Dtl CRISPRa kit - CRISPR gene activation of mouse denticleless E3 ubiquitin protein ligase
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene DTL
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene DTL
DTL - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | mBFP-Neo |
DTL - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | Luciferase-Puro |
DTL - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | RFP-BSD |
DTL HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Dtl (untagged) - Mouse denticleless homolog (Drosophila) (Dtl), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Dtl
DTL (GFP-tagged) - Human denticleless E3 ubiquitin protein ligase homolog (Drosophila) (DTL), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
DTL (GFP-tagged) - Human denticleless E3 ubiquitin protein ligase homolog (Drosophila) (DTL), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
3`UTR clone of denticleless homolog (Drosophila) (DTL) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
DTL (untagged) - Human denticleless E3 ubiquitin protein ligase homolog (Drosophila) (DTL), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
DTL (untagged) - Human denticleless E3 ubiquitin protein ligase homolog (Drosophila) (DTL), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Dtl (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
DTL rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human DTL |
DTL Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 541-730 of human DTL (NP_057532.3). |
| Modifications | Unmodified |
CDT2 Rabbit polyclonal Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human CDT2 |
Active filters
Target Symbol
- DTL