Products

View as table Download

FBP2 (Myc-DDK-tagged)-Human fructose-1,6-bisphosphatase 2 (FBP2)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

FBP2 (GFP-tagged) - Human fructose-1,6-bisphosphatase 2 (FBP2)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human fructose-1,6-bisphosphatase 2 (FBP2), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, FBP2 (Myc-DDK tagged) - Human fructose-1,6-bisphosphatase 2 (FBP2), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human fructose-1,6-bisphosphatase 2 (FBP2), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, FBP2 (mGFP-tagged) - Human fructose-1,6-bisphosphatase 2 (FBP2), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

FBP2 (1-339, His-tag) human protein, 0.1 mg

Tag His-tag
Expression Host E. coli

FBP2 (1-339, His-tag) human protein, 20 µg

Tag His-tag
Expression Host E. coli

Rabbit Polyclonal Anti-FBP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FBP2 antibody: synthetic peptide directed towards the middle region of human FBP2. Synthetic peptide located within the following region: YIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKNQ

FBP2 mouse monoclonal antibody, clone AT1E11, Purified

Applications ELISA, WB
Reactivities Human

FBP2 mouse monoclonal antibody, clone AT1E11, Purified

Applications ELISA, WB
Reactivities Human

FBP2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

FBP2 (C-term) rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of human FBP2

Rabbit Polyclonal Anti-FBP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FBP2 antibody: synthetic peptide directed towards the middle region of human FBP2. Synthetic peptide located within the following region: YAKYFDAATTEYVQKKKFPEDGSAPYGARYVGSMVADVHRTLVYGGIFLY

FBP2 (1-339, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli

FBP2 (1-339, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli

FBP2 MS Standard C13 and N15-labeled recombinant protein (NP_003828)

Tag C-Myc/DDK
Expression Host HEK293

FBP2 (untagged)-Human fructose-1,6-bisphosphatase 2 (FBP2)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

Rabbit Polyclonal Anti-FBP2 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human FBP2

Transient overexpression of FBP2 (NM_003837) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of FBP2 (NM_003837) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of FBP2 (NM_003837) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack