Germany
Japan
United Kingdom
China
FBP2 (Myc-DDK-tagged)-Human fructose-1,6-bisphosphatase 2 (FBP2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Fbp2 (Myc-DDK-tagged) - Mouse fructose bisphosphatase 2 (Fbp2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
FBP2 (GFP-tagged) - Human fructose-1,6-bisphosphatase 2 (FBP2)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
FBP2 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN421146 is the updated version of KN221146.
Fbp2 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN505782 is the updated version of KN305782.
Fbp2 (GFP-tagged) - Mouse fructose bisphosphatase 2 (Fbp2)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Fbp2 (Myc-DDK-tagged) - Mouse fructose bisphosphatase 2 (Fbp2)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Fbp2 (Myc-DDK-tagged) - Mouse fructose bisphosphatase 2 (Fbp2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Fbp2 (mGFP-tagged) - Mouse fructose bisphosphatase 2 (Fbp2)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Fbp2 (GFP-tagged) - Mouse fructose bisphosphatase 2 (Fbp2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human fructose-1,6-bisphosphatase 2 (FBP2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, FBP2 (Myc-DDK tagged) - Human fructose-1,6-bisphosphatase 2 (FBP2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human fructose-1,6-bisphosphatase 2 (FBP2), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, FBP2 (mGFP-tagged) - Human fructose-1,6-bisphosphatase 2 (FBP2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Fbp2 (Myc-DDK-tagged ORF) - Rat fructose-1,6-bisphosphatase 2 (Fbp2), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Fbp2 (Myc-DDK-tagged ORF) - Rat fructose-1,6-bisphosphatase 2 (Fbp2), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Fbp2 (Myc-DDK-tagged ORF) - Rat fructose-1,6-bisphosphatase 2 (Fbp2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Fbp2 (mGFP-tagged ORF) - Rat fructose-1,6-bisphosphatase 2 (Fbp2), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Fbp2 (GFP-tagged ORF) - Rat fructose-1,6-bisphosphatase 2 (Fbp2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
FBP2 (1-339, His-tag) human protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
FBP2 (1-339, His-tag) human protein, 20 µg
| Tag | His-tag |
| Expression Host | E. coli |
Rabbit Polyclonal Anti-FBP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FBP2 antibody: synthetic peptide directed towards the middle region of human FBP2. Synthetic peptide located within the following region: YIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKNQ |
FBP2 mouse monoclonal antibody, clone AT1E11, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
FBP2 mouse monoclonal antibody, clone AT1E11, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
FBP2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Fbp2 (untagged) - Mouse fructose bisphosphatase 2 (Fbp2), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
FBP2 (C-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human FBP2 |
Rabbit Polyclonal Anti-FBP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FBP2 antibody: synthetic peptide directed towards the middle region of human FBP2. Synthetic peptide located within the following region: YAKYFDAATTEYVQKKKFPEDGSAPYGARYVGSMVADVHRTLVYGGIFLY |
FBP2 (1-339, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
FBP2 (1-339, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
FBP2 CRISPRa kit - CRISPR gene activation of human fructose-bisphosphatase 2
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Fbp2 CRISPRa kit - CRISPR gene activation of mouse fructose bisphosphatase 2
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qSTAR qPCR primer pairs against Homo sapiens gene FBP2
Transient overexpression lysate of fructose-1,6-bisphosphatase 2 (FBP2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
qPCR primer pairs and template standards against Mus musculus gene Fbp2
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Mus musculus gene Fbp2
FBP2 MS Standard C13 and N15-labeled recombinant protein (NP_003828)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Fbp2 (untagged ORF) - Rat fructose-1,6-bisphosphatase 2 (Fbp2), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
FBP2 (untagged)-Human fructose-1,6-bisphosphatase 2 (FBP2)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
FBP2 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Fbp2 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Fbp2 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Rabbit Polyclonal Anti-FBP2 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human FBP2 |
FBP2 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human FBP2 |
FBP2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-339 of human FBP2 (NP_003828.2). |
| Modifications | Unmodified |
FBP2 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-339 of human FBP2 (NP_003828.2). |
| Modifications | Unmodified |
Transient overexpression of FBP2 (NM_003837) in HEK293T cells paraffin embedded controls for ICC/IHC staining
FBP2 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
FBP2 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Fbp2 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Active filters
Target Symbol
- FBP2