Products

cDNA Clones (14)
Proteins (8)
Antibodies (2)
Jump to Filters
View as table Download
FBXO16 (NM_172366) Human Tagged ORF Clone
RC221371

USD 420.00

In Stock

FBXO16 (Myc-DDK-tagged)-Human F-box protein 16 (FBXO16)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
FBXO16 (NM_172366) Human Tagged ORF Clone
RG221371

USD 460.00

In Stock

FBXO16 (GFP-tagged) - Human F-box protein 16 (FBXO16)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
FBXO16 (NM_172366) Human Tagged ORF Clone
RC221371L3

USD 620.00

3 Weeks

Lenti ORF clone of Human F-box protein 16 (FBXO16), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
FBXO16 (NM_172366) Human Tagged ORF Clone
RC221371L4

USD 620.00

3 Weeks

Lenti ORF clone of Human F-box protein 16 (FBXO16), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
FBXO16 (NM_001258211) Human Tagged ORF Clone
RC232367

USD 420.00

2 Weeks

FBXO16 (Myc-DDK tagged) - Homo sapiens F-box protein 16 (FBXO16), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
FBXO16 (NM_001258211) Human Tagged ORF Clone
RG232367

USD 460.00

3 Weeks

FBXO16 (GFP-tagged) - Homo sapiens F-box protein 16 (FBXO16), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
FBXO16 (NM_172366) Human Tagged ORF Clone
RC221371L1

USD 768.00

In Stock

Lenti ORF clone of Human F-box protein 16 (FBXO16), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
FBXO16 (NM_172366) Human Tagged ORF Clone
RC221371L2

USD 620.00

3 Weeks

Lenti ORF clone of Human F-box protein 16 (FBXO16), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
FBXO16 Rabbit Polyclonal Antibody
TA337798

USD 375.00

5 Days

Rabbit Polyclonal Anti-FBXO16 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FBXO16 antibody: synthetic peptide directed towards the N terminal of human FBXO16. Synthetic peptide located within the following region: CRKLQEKIPAEALDFTTKLPRVLSLYIFSFLDPRSLCRCAQVCWHWKNLA
FBXO16 (NM_172366) Human Recombinant Protein
TP761880

USD 215.00

In Stock

Purified recombinant protein of Human F-box protein 16 (FBXO16), full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug

Tag N-GST and C-His
Expression Host E. coli
FBXO16 Rabbit Polyclonal Antibody
TA337799

USD 375.00

5 Days

Rabbit Polyclonal Anti-FBXO16 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FBXO16 antibody: synthetic peptide directed towards the C terminal of human FBXO16. Synthetic peptide located within the following region: SPLSAFRSSSSLRKKNNSGEKALPPWRSSDKHPTDIIRFNYLDNRDPMET
FBXO16 (NM_172366) Human Over-expression Lysate
LC406732

USD 121.00

2 Weeks

FBXO16 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
FBXO16 (NM_172366) Human Over-expression Lysate
LY406732

USD 396.00

5 Days

Transient overexpression lysate of F-box protein 16 (FBXO16)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
FBXO16 (NM_172366) Human Untagged Clone
SC306761

USD 660.00

3 Weeks

FBXO16 (untagged)-Human F-box protein 16 (FBXO16)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
FBXO16 (NM_001258211) Human Untagged Clone
SC330639

USD 310.00

3 Weeks

FBXO16 (untagged) - Homo sapiens F-box protein 16 (FBXO16), transcript variant 2

Vector pCMV6 series
Tag Tag Free
FBXO16 (NM_172366) ICC Control Block
TB421371

USD 1,070.00

4 Weeks

Transient overexpression of FBXO16 (NM_172366) in HEK293T cells paraffin embedded controls for ICC/IHC staining

FBXO16 (NM_001258211) ICC Control Block
TB432367

USD 1,070.00

4 Weeks

Transient overexpression of FBXO16 (NM_001258211) in HEK293T cells paraffin embedded controls for ICC/IHC staining

FBXO16 Cytosection
TS421371

USD 225.00

4 Weeks

Transient overexpression of FBXO16 (NM_172366) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

FBXO16 Cytosection
TS421371P5

USD 889.00

4 Weeks

Transient overexpression of FBXO16 (NM_172366) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

FBXO16 ICC Control Sections
TS432367P5

USD 889.00

4 Weeks

Transient overexpression of FBXO16 (NM_001258211) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack