Products

cDNA Clones (7)
Antibodies (3)
Proteins (3)
Jump to Filters
View as table Download
HSD17B12 (NM_016142) Human Tagged ORF Clone
RC202385

USD 420.00

In Stock

HSD17B12 (Myc-DDK-tagged)-Human hydroxysteroid (17-beta) dehydrogenase 12 (HSD17B12)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
HSD17B12 (NM_016142) Human Tagged ORF Clone
RC202385L3

USD 620.00

3 Weeks

Lenti-ORF clone of HSD17B12 (Myc-DDK-tagged)-Human hydroxysteroid (17-beta) dehydrogenase 12 (HSD17B12)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
HSD17B12 (NM_016142) Human Tagged ORF Clone Lentiviral Particle
RC202385L3V

USD 820.00

6 Weeks

Lenti ORF particles, HSD17B12 (Myc-DDK-tagged)-Human hydroxysteroid (17-beta) dehydrogenase 12 (HSD17B12), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
HSD17B12 (NM_016142) Human Tagged ORF Clone
RC202385L4

USD 620.00

3 Weeks

Lenti-ORF clone of HSD17B12 (mGFP-tagged)-Human hydroxysteroid (17-beta) dehydrogenase 12 (HSD17B12)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
HSD17B12 (NM_016142) Human Tagged ORF Clone Lentiviral Particle
RC202385L4V

USD 820.00

6 Weeks

Lenti ORF particles, HSD17B12 (mGFP-tagged)-Human hydroxysteroid (17-beta) dehydrogenase 12 (HSD17B12), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
HSD17B12 (NM_016142) Human Tagged ORF Clone
RG202385

USD 460.00

3 Weeks

HSD17B12 (GFP-tagged) - Human hydroxysteroid (17-beta) dehydrogenase 12 (HSD17B12)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
HSD17B12 (NM_016142) Human Untagged Clone
SC114479

USD 310.00

In Stock

HSD17B12 (untagged)-Human hydroxysteroid (17-beta) dehydrogenase 12 (HSD17B12)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
HSD17B12 (Center) Rabbit Polyclonal Antibody
AP52110PU-N

USD 450.00

2 Weeks

HSD17B12 (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 133~163 amino acids from the Center region of human 17-beta-HSD12 / HSD17B12
HSD17B12 Rabbit Polyclonal Antibody
TA341998

USD 375.00

5 Days

Rabbit Polyclonal Anti-Hsd17b12 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Hsd17b12 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Hsd17b12. Synthetic peptide located within the following region: SAETFVKSAIKTVGLQTRTTGYVIHSLMGSINSIMPRWMYFKIIMGFSKS
HSD17B12 Rabbit Polyclonal Antibody
TA350058

USD 345.00

In Stock

Rabbit Polyclonal Anti-HSD17B12 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human HSD17B12
HSD17B12 (NM_016142) ICC Control Block
TB402385

USD 1,070.00

4 Weeks

Transient overexpression of HSD17B12 (NM_016142) in HEK293T cells paraffin embedded controls for ICC/IHC staining

HSD17B12 Cytosection
TS402385

USD 225.00

4 Weeks

Transient overexpression of HSD17B12 (NM_016142) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

HSD17B12 Cytosection
TS402385P5

USD 889.00

4 Weeks

Transient overexpression of HSD17B12 (NM_016142) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack