Germany
Japan
United Kingdom
China
HSD17B12 (Myc-DDK-tagged)-Human hydroxysteroid (17-beta) dehydrogenase 12 (HSD17B12)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table Download
Hsd17b12 (GFP-tagged) - Mouse hydroxysteroid (17-beta) dehydrogenase 12 (Hsd17b12), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Hsd17b12 (Myc-DDK-tagged) - Mouse hydroxysteroid (17-beta) dehydrogenase 12 (cDNA clone MGC:46848 IMAGE:5375831)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Hsd17b12 (Myc-DDK-tagged) - Mouse hydroxysteroid (17-beta) dehydrogenase 12 (Hsd17b12)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
HSD17B12 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN402385 is the updated version of KN202385.
Hsd17b12 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN507968 is the updated version of KN307968.
Hsd17b12 (GFP-tagged) - Mouse hydroxysteroid (17-beta) dehydrogenase 12 (cDNA clone MGC:46848 IMAGE:5375831)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Hsd17b12 (Myc-DDK-tagged) - Mouse hydroxysteroid (17-beta) dehydrogenase 12 (cDNA clone MGC:46848 IMAGE:5375831)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Hsd17b12 (Myc-DDK-tagged) - Mouse hydroxysteroid (17-beta) dehydrogenase 12 (cDNA clone MGC:46848 IMAGE:5375831), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Hsd17b12 (mGFP-tagged) - Mouse hydroxysteroid (17-beta) dehydrogenase 12 (cDNA clone MGC:46848 IMAGE:5375831)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Hsd17b12 (GFP-tagged) - Mouse hydroxysteroid (17-beta) dehydrogenase 12 (cDNA clone MGC:46848 IMAGE:5375831), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Hsd17b12 (Myc-DDK-tagged) - Mouse hydroxysteroid (17-beta) dehydrogenase 12 (Hsd17b12)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Hsd17b12 (Myc-DDK-tagged) - Mouse hydroxysteroid (17-beta) dehydrogenase 12 (Hsd17b12), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Hsd17b12 (mGFP-tagged) - Mouse hydroxysteroid (17-beta) dehydrogenase 12 (Hsd17b12)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Hsd17b12 (GFP-tagged) - Mouse hydroxysteroid (17-beta) dehydrogenase 12 (Hsd17b12), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of HSD17B12 (Myc-DDK-tagged)-Human hydroxysteroid (17-beta) dehydrogenase 12 (HSD17B12)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, HSD17B12 (Myc-DDK-tagged)-Human hydroxysteroid (17-beta) dehydrogenase 12 (HSD17B12), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of HSD17B12 (mGFP-tagged)-Human hydroxysteroid (17-beta) dehydrogenase 12 (HSD17B12)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, HSD17B12 (mGFP-tagged)-Human hydroxysteroid (17-beta) dehydrogenase 12 (HSD17B12), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
HSD17B12 (GFP-tagged) - Human hydroxysteroid (17-beta) dehydrogenase 12 (HSD17B12)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Hsd17b12 (Myc-DDK-tagged ORF) - Rat hydroxysteroid (17-beta) dehydrogenase 12 (Hsd17b12), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Hsd17b12 (Myc-DDK-tagged ORF) - Rat hydroxysteroid (17-beta) dehydrogenase 12 (Hsd17b12), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Hsd17b12 (Myc-DDK-tagged ORF) - Rat hydroxysteroid (17-beta) dehydrogenase 12 (Hsd17b12), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Hsd17b12 (mGFP-tagged ORF) - Rat hydroxysteroid (17-beta) dehydrogenase 12 (Hsd17b12), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Hsd17b12 (GFP-tagged ORF) - Rat hydroxysteroid (17-beta) dehydrogenase 12 (Hsd17b12), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
HSD17B12 (untagged)-Human hydroxysteroid (17-beta) dehydrogenase 12 (HSD17B12)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Hsd17b12 (untagged) - Mouse hydroxysteroid (17-beta) dehydrogenase 12 (cDNA clone MGC:46848 IMAGE:5375831), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
HSD17B12 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
SR324050 is the updated version of SR309573.
Rabbit Polyclonal Anti-Hsd17b12 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Hsd17b12 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Hsd17b12. Synthetic peptide located within the following region: SAETFVKSAIKTVGLQTRTTGYVIHSLMGSINSIMPRWMYFKIIMGFSKS |
HSD17B12 CRISPRa kit - CRISPR gene activation of human hydroxysteroid 17-beta dehydrogenase 12
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene HSD17B12
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene HSD17B12
Hsd17b12 (untagged) - Mouse hydroxysteroid (17-beta) dehydrogenase 12 (Hsd17b12), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Hsd17b12
Hsd17b12 (untagged ORF) - Rat hydroxysteroid (17-beta) dehydrogenase 12 (Hsd17b12), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of hydroxysteroid (17-beta) dehydrogenase 12 (HSD17B12) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
Hsd17b12 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Hsd17b12 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
HSD17B12 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human DHB12 |
HSD17B12 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 43-312 of human HSD17B12 (NP_057226.1). |
Transient overexpression of HSD17B12 (NM_016142) in HEK293T cells paraffin embedded controls for ICC/IHC staining
HSD17B12 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
HSD17B12 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Hsd17b12 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Hsd17b12 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Hsd17b12 - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Hsd17b12 - Rat shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Active filters
Target Symbol
- HSD17B12