Germany
Japan
United Kingdom
China
OTX1 (Myc-DDK-tagged)-Human orthodenticle homeobox 1 (OTX1), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, OTX1 (Myc-DDK tagged) - Human orthodenticle homeobox 1 (OTX1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, OTX1 (mGFP-tagged) - Human orthodenticle homeobox 1 (OTX1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
OTX1 (Myc-DDK tagged) - Homo sapiens orthodenticle homeobox 1 (OTX1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
OTX1 (GFP-tagged) - Human orthodenticle homeobox 1 (OTX1), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human orthodenticle homeobox 1 (OTX1), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, OTX1 (Myc-DDK tagged) - Human orthodenticle homeobox 1 (OTX1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human orthodenticle homeobox 1 (OTX1), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, OTX1 (mGFP-tagged) - Human orthodenticle homeobox 1 (OTX1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
OTX1 (GFP-tagged) - Homo sapiens orthodenticle homeobox 1 (OTX1), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human orthodenticle homeobox 1 (OTX1), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
OTX1 (untagged)-Human orthodenticle homeobox 1 (OTX1), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-OTX1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OTX1 antibody: synthetic peptide directed towards the N terminal of human OTX1. Synthetic peptide located within the following region: PRKQRRERTTFTRSQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQV |
Rabbit Polyclonal Anti-OTX1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OTX1 antibody: synthetic peptide directed towards the C terminal of human OTX1. Synthetic peptide located within the following region: HHQGYGGSGLAFNSADCLDYKEPGAAAASSAWKLNFNSPDCLDYKDQASW |
Transient overexpression lysate of orthodenticle homeobox 1 (OTX1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human orthodenticle homeobox 1 (OTX1), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Purified recombinant protein of Human orthodenticle homeobox 1 (OTX1), transcript variant 1, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug
| Tag | N-GST and C-His |
| Expression Host | E. coli |
OTX1 (untagged)-Human orthodenticle homeobox 1 (OTX1), transcript variant 1
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
OTX1 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 86-116 amino acids from the Central region of human OTX1 |
Rabbit Polyclonal Anti-OTX1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OTX1 antibody: synthetic peptide directed towards the N terminal of human OTX1. Synthetic peptide located within the following region: KINLPESRVQVWFKNRRAKCRQQQQSGSGTKSRPAKKKSSPVRESSGSES |
Rabbit Polyclonal Anti-OTX1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OTX1 antibody: synthetic peptide directed towards the C terminal of human OTX1. Synthetic peptide located within the following region: SGLAFNSADCLDYKEPGAAAASSAWKLNFNSPDCLDYKDQASWRFQVL |
Rabbit Polyclonal Anti-OTX1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OTX1 antibody: synthetic peptide directed towards the middle region of human OTX1. Synthetic peptide located within the following region: ISPGSAPASVSVPEPLAAPSNTSCMQRSVAAGAATAAASYPMSYGQGGSY |
OTX1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
OTX1 (untagged) - Homo sapiens orthodenticle homeobox 1 (OTX1), transcript variant 2
| Vector | pCMV6 series |
| Tag | Tag Free |
Transient overexpression of OTX1 (NM_014562) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of OTX1 (NM_001199770) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of OTX1 (NM_014562) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of OTX1 (NM_014562) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of OTX1 (NM_001199770) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of OTX1 (NM_001199770) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- OTX1
Families
- Druggable Genome