Products

cDNA Clones (14)
Proteins (8)
Antibodies (3)
Jump to Filters
View as table Download
SUV39H1 (NM_003173) Human Tagged ORF Clone
RC202428

USD 420.00

In Stock

SUV39H1 (Myc-DDK-tagged)-Human suppressor of variegation 3-9 homolog 1 (Drosophila) (SUV39H1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
SUV39H1 (NM_003173) Human Tagged ORF Clone
RG202428

USD 460.00

In Stock

SUV39H1 (GFP-tagged) - Human suppressor of variegation 3-9 homolog 1 (Drosophila) (SUV39H1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SUV39H1 (NM_003173) Human Untagged Clone
SC319503

USD 310.00

In Stock

SUV39H1 (untagged)-Human suppressor of variegation 3-9 homolog 1 (Drosophila) (SUV39H1)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
SUV39H1 (NM_003173) Human Tagged ORF Clone Lentiviral Particle
RC202428L1V

USD 820.00

3 Weeks

Lenti ORF particles, SUV39H1 (Myc-DDK tagged) - Human suppressor of variegation 3-9 homolog 1 (Drosophila) (SUV39H1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
SUV39H1 (NM_003173) Human Tagged ORF Clone Lentiviral Particle
RC202428L2V

USD 820.00

6 Weeks

Lenti ORF particles, SUV39H1 (mGFP-tagged) - Human suppressor of variegation 3-9 homolog 1 (Drosophila) (SUV39H1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
SUV39H1 (NM_001282166) Human Tagged ORF Clone
RC238140

USD 420.00

In Stock

SUV39H1 (myc-DDK-tagged) - Human suppressor of variegation 3-9 homolog 1 (Drosophila) (SUV39H1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
SUV39H1 (NM_003173) Human Tagged ORF Clone
RC202428L3

USD 620.00

3 Weeks

Lenti ORF clone of Human suppressor of variegation 3-9 homolog 1 (Drosophila) (SUV39H1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SUV39H1 (NM_003173) Human Tagged ORF Clone Lentiviral Particle
RC202428L3V

USD 820.00

5 Weeks

Lenti ORF particles, SUV39H1 (Myc-DDK tagged) - Human suppressor of variegation 3-9 homolog 1 (Drosophila) (SUV39H1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SUV39H1 (NM_003173) Human Tagged ORF Clone Lentiviral Particle
RC202428L4V

USD 820.00

3 Weeks

Lenti ORF particles, SUV39H1 (mGFP-tagged) - Human suppressor of variegation 3-9 homolog 1 (Drosophila) (SUV39H1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SUV39H1 (NM_003173) Human Tagged ORF Clone
RC202428L1

USD 768.00

In Stock

Lenti ORF clone of Human suppressor of variegation 3-9 homolog 1 (Drosophila) (SUV39H1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
SUV39H1 (NM_003173) Human Over-expression Lysate
LY418862

USD 396.00

In Stock

Transient overexpression lysate of suppressor of variegation 3-9 homolog 1 (Drosophila) (SUV39H1)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SUV39H1 Rabbit Polyclonal Antibody
TA330558

USD 310.00

2 Weeks

Rabbit Polyclonal Anti-SUV39H1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SUV39H1 antibody: synthetic peptide directed towards the C terminal of human SUV39H1. Synthetic peptide located within the following region: FDYNMQVDPVDMESTRMDSNFGLAGLPGSPKKRVRIECKCGTESCRKYLF
SUV39H1 (NM_003173) Human Tagged ORF Clone
RC202428L2

USD 620.00

3 Weeks

Lenti ORF clone of Human suppressor of variegation 3-9 homolog 1 (Drosophila) (SUV39H1), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
SUV39H1 (NM_003173) Human Over-expression Lysate
LC418862

USD 121.00

In Stock

SUV39H1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SUV39H1 (N-term) Mouse Monoclonal Antibody [Clone ID: 42AT239.96.72]
AM11036PU-N

USD 450.00

2 Weeks

SUV39H1 (N-term) mouse monoclonal antibody, clone 42AT239.96.72, Purified

Applications WB
Reactivities Human, Mouse
SUV39H1 Rabbit Polyclonal Antibody
TA330559

USD 375.00

5 Days

Rabbit Polyclonal Anti-SUV39H1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SUV39H1 antibody: synthetic peptide directed towards the N terminal of human SUV39H1. Synthetic peptide located within the following region: RHLDPSLANYLVQKAKQRRALRRWEQELNAKRSHLGRITVENEVDLDGPP
SUV39H1 (NM_001282166) Human Tagged ORF Clone
RG238140

USD 460.00

2 Weeks

SUV39H1 (GFP-tagged) - Human suppressor of variegation 3-9 homolog 1 (Drosophila) (SUV39H1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SUV39H1 (NM_001282166) Human Untagged Clone
SC336034

USD 420.00

2 Weeks

SUV39H1 (untagged) - Human suppressor of variegation 3-9 homolog 1 (Drosophila) (SUV39H1), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
SUV39H1 ICC Control Block
TB402428

USD 1,070.00

4 Weeks

Transient overexpression of SUV39H1 (NM_003173) in HEK293T cells paraffin embedded controls for ICC/IHC staining

SUV39H1 ICC Control Block
TB438140

USD 1,070.00

4 Weeks

Transient overexpression of SUV39H1 (NM_001282166) in HEK293T cells paraffin embedded controls for ICC/IHC staining

SUV39H1 Cytosection
TS402428

USD 225.00

4 Weeks

Transient overexpression of SUV39H1 (NM_003173) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

SUV39H1 Cytosection
TS402428P5

USD 889.00

4 Weeks

Transient overexpression of SUV39H1 (NM_003173) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

SUV39H1 Cytosection
TS438140

USD 225.00

4 Weeks

Transient overexpression of SUV39H1 (NM_001282166) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

SUV39H1 Cytosection
TS438140P5

USD 889.00

4 Weeks

Transient overexpression of SUV39H1 (NM_001282166) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack