Products

View as table Download

TKT (GFP-tagged) - Human transketolase (TKT), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Rabbit monoclonal anti-TKT antibody for SISCAPA, clone OTIR4F5

Applications SISCAPA
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

TKT (Myc-DDK tagged) - Homo sapiens transketolase (TKT), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

TKT (GFP-tagged) - Human transketolase (TKT), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

TKT (GFP-tagged) - Homo sapiens transketolase (TKT), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

TKT (untagged)-Human transketolase (TKT), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

Rabbit Polyclonal Anti-TKT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TKT antibody: synthetic peptide directed towards the N terminal of human TKT. Synthetic peptide located within the following region: ESYHKPDQQKLQALKDTANRLRISSIQATTAAGSGHPTSCCSAAEIMAVL

Lenti ORF clone of Human transketolase (TKT), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human transketolase (TKT), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

TKT HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T

Transient overexpression lysate of transketolase (TKT), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transketolase (TKT) (1-623, His-tag) human recombinant protein, 0.25 mg

Tag His-tag
Expression Host E. coli

Transketolase (TKT) (1-623, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli

Carrier-free (BSA/glycerol-free) TKT mouse monoclonal antibody, clone OTI5H3 (formerly 5H3)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

TKT HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of transketolase (TKT), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

TKT MS Standard C13 and N15-labeled recombinant protein (NP_001055)

Tag C-Myc/DDK
Expression Host HEK293

TKT MS Standard C13 and N15-labeled recombinant protein (NP_001128527)

Tag C-Myc/DDK
Expression Host HEK293

TKT (untagged)-Human transketolase (TKT), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

Rabbit Polyclonal Anti-TKT Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human TKT

Anti-TKT (Transketolase) mouse monoclonal antibody, clone OTI5H3 (formerly 5H3)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-TKT (Transketolase) mouse monoclonal antibody, clone OTI5H3 (formerly 5H3), Biotinylated

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

Anti-TKT (Transketolase) mouse monoclonal antibody, clone OTI5H3 (formerly 5H3), HRP conjugated

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

Anti-TKT (Transketolase) mouse monoclonal antibody, clone OTI5H3 (formerly 5H3)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Transient overexpression of TKT (NM_001064) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of TKT (NM_001135055) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of TKT (NM_001258028) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of TKT (NM_001064) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of TKT (NM_001064) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of TKT (NM_001135055) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of TKT (NM_001135055) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of TKT (NM_001258028) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack