Products

Antibodies (677)
cDNA Clones (363)
Proteins (207)
Jump to Filters
Download
Integrin beta 1 (ITGB1) (NM_002211) Human Recombinant Protein
TP303818

USD 867.00

In Stock

Recombinant protein of human integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) (ITGB1), transcript variant 1A

Tag C-Myc/DDK
Expression Host HEK293T

Special Offer: Get a 20% discount on this product. Use code: "MVPro20".

beta Catenin (CTNNB1) (NM_001904) Human Untagged Clone
SC107921

USD 310.00

In Stock

CTNNB1 (untagged)-Human catenin (cadherin-associated protein), beta 1, 88kDa (CTNNB1), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
beta Actin (ACTB) (NM_001101) Human Untagged Clone
SC319328

USD 310.00

In Stock

ACTB (untagged)-Human actin, beta (ACTB)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
beta Actin (ACTB) Mouse Monoclonal Antibody [Clone ID: 8H10]
TA310155

USD 235.00

2 Weeks

Mouse monoclonal anti-ACTB(beta Actin) antibody, Loading control

Applications WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated
beta Catenin (CTNNB1) (NM_001904) Human Tagged ORF Clone
RC208947

USD 420.00

In Stock

CTNNB1 (Myc-DDK-tagged)-Human catenin (cadherin-associated protein), beta 1, 88kDa (CTNNB1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Integrin beta 1 (ITGB1) (NM_002211) Human Tagged ORF Clone
RC203818

USD 610.00

In Stock

ITGB1 (Myc-DDK-tagged)-Human integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) (ITGB1), transcript variant 1A

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
beta Catenin (CTNNB1) (NM_001904) Human Recombinant Protein
TP308947

USD 867.00

In Stock

Recombinant protein of human catenin (cadherin-associated protein), beta 1, 88kDa (CTNNB1)

Tag C-Myc/DDK
Expression Host HEK293T

Special Offer: Get a 20% discount on this product. Use code: "MVPro20".

CXCR4 (NM_003467) Human Tagged ORF Clone
RC202069

USD 420.00

In Stock

CXCR4 (Myc-DDK-tagged)-Human chemokine (C-X-C motif) receptor 4 (CXCR4), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CXCR4 (NM_003467) Human Untagged Clone
SC117951

USD 310.00

In Stock

CXCR4 (untagged)-Human chemokine (C-X-C motif) receptor 4 (CXCR4), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Integrin beta 1 (ITGB1) (NM_002211) Human Untagged Clone
SC111935

USD 310.00

In Stock

ITGB1 (untagged)-Human integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) (ITGB1), transcript variant 1A

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
SDF1 (CXCL12) (NM_000609) Human Tagged ORF Clone
RC211693

USD 98.00

USD 390.00

In Stock

CXCL12 (Myc-DDK-tagged)-Human chemokine (C-X-C motif) ligand 12 (CXCL12), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
ICAM1 (NM_000201) Human Tagged ORF Clone
RC200714

USD 420.00

In Stock

ICAM1 (Myc-DDK-tagged)-Human intercellular adhesion molecule 1 (ICAM1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
beta Catenin (CTNNB1) (NM_001904) Human Over-expression Lysate
LY419662

USD 396.00

In Stock

Transient overexpression lysate of catenin (cadherin-associated protein), beta 1, 88kDa (CTNNB1), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CD31 (PECAM1) (NM_000442) Human Tagged ORF Clone
RC208654

USD 610.00

In Stock

PECAM1 (Myc-DDK-tagged)-Human platelet/endothelial cell adhesion molecule (PECAM1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
ICAM1 (NM_000201) Human Untagged Clone
SC120049

USD 310.00

In Stock

ICAM1 (untagged)-Human intercellular adhesion molecule 1 (ICAM1)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
beta Catenin (CTNNB1) (NM_001904) Human Tagged ORF Clone
RG208947

USD 460.00

In Stock

CTNNB1 (GFP-tagged) - Human catenin (cadherin-associated protein), beta 1, 88kDa (CTNNB1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CD11a (ITGAL) (NM_002209) Human Recombinant Protein
TP321297

USD 867.00

In Stock

Recombinant protein of human integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) (ITGAL), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T

Special Offer: Get a 20% discount on this product. Use code: "MVPro20".

CD11a (ITGAL) (NM_002209) Human Tagged ORF Clone
RC221297

USD 1,300.00

In Stock

ITGAL (Myc-DDK-tagged)-Human integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1, alpha polypeptide) (ITGAL), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
VCAM1 (NM_001078) Human Tagged ORF Clone Lentiviral Particle
RC209761L2V

USD 1,020.00

3 Weeks

Lenti ORF particles, VCAM1 (mGFP-tagged) - Human vascular cell adhesion molecule 1 (VCAM1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
ICAM1 (NM_000201) Human Tagged ORF Clone Lentiviral Particle
RC200714L4V

USD 1,020.00

3 Weeks

Lenti ORF particles, ICAM1 (mGFP-tagged) - Human intercellular adhesion molecule 1 (ICAM1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Integrin beta 1 (ITGB1) (NM_033668) Human Tagged ORF Clone
RC211902

USD 610.00

In Stock

ITGB1 (Myc-DDK-tagged)-Human integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) (ITGB1), transcript variant 1D

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
VCAM1 (NM_001078) Human Tagged ORF Clone
RC209761

USD 420.00

In Stock

VCAM1 (Myc-DDK-tagged)-Human vascular cell adhesion molecule 1 (VCAM1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
beta Catenin (CTNNB1) (NM_001098209) Human Tagged ORF Clone
RC212056

USD 420.00

In Stock

CTNNB1 (Myc-DDK-tagged)-Human catenin (cadherin-associated protein), beta 1, 88kDa (CTNNB1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CD11b (ITGAM) (NM_000632) Human Tagged ORF Clone
RC221743

USD 1,210.00

In Stock

ITGAM (Myc-DDK-tagged)-Human integrin, alpha M (complement component 3 receptor 3 subunit) (ITGAM), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Integrin beta 1 (ITGB1) (NM_133376) Human Tagged ORF Clone
RC215247

USD 610.00

In Stock

ITGB1 (Myc-DDK-tagged)-Human integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) (ITGB1), transcript variant 1E

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CXCR4 (NM_001008540) Human Tagged ORF Clone
RG214548

USD 460.00

In Stock

CXCR4 (GFP-tagged) - Human chemokine (C-X-C motif) receptor 4 (CXCR4), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
beta Catenin (CTNNB1) (NM_001098210) Human Tagged ORF Clone
RC214557

USD 420.00

In Stock

CTNNB1 (Myc-DDK-tagged)-Human catenin (cadherin-associated protein), beta 1, 88kDa (CTNNB1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PKC alpha (PRKCA) (NM_002737) Human Tagged ORF Clone
RC211893

USD 420.00

In Stock

PRKCA (Myc-DDK-tagged)-Human protein kinase C, alpha (PRKCA)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CXCR4 (NM_001008540) Human Tagged ORF Clone
RC214548

USD 420.00

In Stock

CXCR4 (Myc-DDK-tagged)-Human chemokine (C-X-C motif) receptor 4 (CXCR4), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
SDF1 (CXCL12) (NM_199168) Human Recombinant Protein
TP307891

USD 823.00

In Stock

Purified recombinant protein of human chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) (CXCL12), transcript variant 1, with C-terminal MYC/DDK tag, secretory expressed in HEK293 cells, 20ug

Tag C-Myc/DDK
Expression Host HEK293T

Special Offer: Get a 20% discount on this product. Use code: "MVPro20".

Integrin beta 1 (ITGB1) (NM_002211) Human Tagged ORF Clone
RG203818

USD 670.00

In Stock

ITGB1 (GFP-tagged) - Human integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) (ITGB1), transcript variant 1A

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CXCR4 (NM_001008540) Human Untagged Clone
SC301321

USD 610.00

In Stock

CXCR4 (untagged)-Human chemokine (C-X-C motif) receptor 4 (CXCR4), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
SDF1 (CXCL12) (NM_199168) Human Tagged ORF Clone
RC207891

USD 98.00

USD 390.00

In Stock

CXCL12 (Myc-DDK-tagged)-Human chemokine (C-X-C motif) ligand 12 (CXCL12), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CD90 (THY1) (NM_006288) Human Tagged ORF Clone
RC209458

USD 98.00

USD 390.00

In Stock

THY1 (Myc-DDK-tagged)-Human Thy-1 cell surface antigen (THY1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PKC alpha (PRKCA) (NM_002737) Human Tagged ORF Clone
RG211893

USD 460.00

In Stock

PRKCA (GFP-tagged) - Human protein kinase C, alpha (PRKCA)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
VE Cadherin (CDH5) (NM_001795) Human Tagged ORF Clone
RC223907

USD 870.00

In Stock

CDH5 (Myc-DDK-tagged)-Human cadherin 5, type 2 (vascular endothelium) (CDH5)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CXCR4 (NM_003467) Human Tagged ORF Clone
RG202069

USD 460.00

In Stock

CXCR4 (GFP-tagged) - Human chemokine (C-X-C motif) receptor 4 (CXCR4), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
beta Catenin (CTNNB1) (NM_001904) Human Mutant ORF Clone
RC400211

USD 780.00

In Stock

CTNNB1 Mutant (S33A), Myc-DDK-tagged ORF clone of Homo sapiens catenin (cadherin-associated protein), beta 1, 88kDa (CTNNB1), transcript variant 1 as transfection-ready DNA

Mutation S33A
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
beta Actin (ACTB) Rabbit Polyclonal Antibody
TA345667

USD 475.00

5 Days

Rabbit Polyclonal Anti-ACTB Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK
CD90 (THY1) (NM_006288) Human Tagged ORF Clone
RG209458

USD 460.00

In Stock

THY1 (GFP-tagged) - Human Thy-1 cell surface antigen (THY1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®