Products

View as table Download

WNT6 (Myc-DDK-tagged)-Human wingless-type MMTV integration site family, member 6 (WNT6)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, WNT6 (Myc-DDK tagged) - Human wingless-type MMTV integration site family, member 6 (WNT6), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, WNT6 (mGFP-tagged) - Human wingless-type MMTV integration site family, member 6 (WNT6), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

WNT6 (GFP-tagged) - Human wingless-type MMTV integration site family, member 6 (WNT6)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human wingless-type MMTV integration site family, member 6 (WNT6), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, WNT6 (Myc-DDK tagged) - Human wingless-type MMTV integration site family, member 6 (WNT6), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human wingless-type MMTV integration site family, member 6 (WNT6), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, WNT6 (mGFP-tagged) - Human wingless-type MMTV integration site family, member 6 (WNT6), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

WNT6 (untagged)-Human wingless-type MMTV integration site family, member 6 (WNT6)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

Lenti ORF clone of Human wingless-type MMTV integration site family, member 6 (WNT6), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Transient overexpression lysate of wingless-type MMTV integration site family, member 6 (WNT6)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Rabbit polyclonal anti-Wnt-6 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 276 of mouse Wnt-6

WNT6 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T

Lenti ORF clone of Human wingless-type MMTV integration site family, member 6 (WNT6), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Purified recombinant protein of Human wingless-type MMTV integration site family, member 6 (WNT6),Pro32-Phe82, with N-terminal His-ABP tag, expressed in E. coli, 50ug

Tag N-His-ABP
Expression Host E. coli

WNT6 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 172-201 amino acids from the Central region of human WNT6

WNT6 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Gibbon, Bovine, Dog, Gorilla, Horse, Human, Rabbit
Conjugation Unconjugated
Immunogen WNT6 antibody was raised against synthetic 18 amino acid peptide from internal region of human WNT6. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Elephant, Bovine, Dog, Bat, Horse, Rabbit, Opossum (100%); Marmoset, Mouse, Rat, Hamster, Platypus (94%); Turkey, Chicken (83%).

WNT6 Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Dog, Gorilla, Hamster, Horse, Human, Mouse, Rabbit, Rat
Immunogen WNT6 antibody was raised against synthetic 20 amino acid peptide from N-terminus of human WNT6. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Horse, Rabbit (100%); Marmoset, Bat, Opossum, Platypus (95%).

Rabbit Polyclonal Anti-WNT6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WNT6 antibody: synthetic peptide directed towards the middle region of human WNT6. Synthetic peptide located within the following region: ERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRTG

Rabbit Polyclonal Anti-WNT6 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human WNT6

USD 1,070.00

4 Weeks

Transient overexpression of WNT6 (NM_006522) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Purified recombinant protein of Human wingless-type MMTV integration site family, member 6 (WNT6), full length, with N-GST and C-His tag, expressed in E.coli, 50ug

Tag N-GST and C-HIS
Expression Host E. coli

USD 225.00

4 Weeks

Transient overexpression of WNT6 (NM_006522) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of WNT6 (NM_006522) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack