Products

View as table Download

SHH (GFP-tagged) - Human sonic hedgehog (SHH)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

SHH (untagged)-Human sonic hedgehog (SHH)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Sonic hedgehog (SHH) human protein, 25 µg

Expression Host E. coli

Sonic hedgehog (SHH) human protein, 5 µg

Expression Host E. coli

Mouse Monoclonal Sonic Hedgehog/Shh Antibody (5H4)

Applications ELISA, FC, IHC, WB
Reactivities Human, Mouse, Primate
Conjugation Unconjugated

Rabbit Polyclonal Sonic Hedgehog/Shh Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide made to an N-terminal portion of the human SHH protein (between residues 1-75) [UniProt Q15465]

Sonic Hedgehog (SHH) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen A synthetic peptide corresponding to a sequence near the N-terminal of human SHH

SHH HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Rabbit Polyclonal Anti-SHH Antibody

Applications IHC, WB
Reactivities Chicken, Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SHH antibody: synthetic peptide directed towards the N terminal of human SHH. Synthetic peptide located within the following region: RCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKT

Sonic hedgehog (SHH) (24-197, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli

Sonic hedgehog (SHH) (24-197, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli

Sonic hedgehog (SHH) (24-197, ) human recombinant protein, 0.25 mg

Expression Host E. coli

Sonic hedgehog (SHH) (24-197, ) human recombinant protein, 50 µg

Expression Host E. coli

Carrier-free (BSA/glycerol-free) SHH mouse monoclonal antibody, clone OTI3A2 (formerly 3A2)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SHH mouse monoclonal antibody, clone OTI10H6 (formerly 10H6)

Applications IF, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

SHH MS Standard C13 and N15-labeled recombinant protein (NP_000184)

Tag C-Myc/DDK
Expression Host HEK293

Anti-SHH Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 448-462 amino acids of Human sonic hedgehog

Anti-SHH Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 448-462 amino acids of Human sonic hedgehog

Anti-SHH (Sonic Hedgehog) mouse monoclonal antibody, clone OTI3A2 (formerly 3A2)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-SHH (Sonic Hedgehog) mouse monoclonal antibody, clone OTI3A2 (formerly 3A2)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

SHH (Sonic Hedgehog) mouse monoclonal antibody, clone OTI10H6 (formerly 10H6)

Applications IF, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

SHH (Sonic Hedgehog) mouse monoclonal antibody, clone OTI10H6 (formerly 10H6)

Applications IF, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Transient overexpression of SHH (NM_000193) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Purified recombinant protein of Human sonic hedgehog (SHH)

Tag tag free
Expression Host E. coli

Purified recombinant protein of Human sonic hedgehog (SHH)

Tag tag free
Expression Host E. coli

Purified recombinant protein of Human sonic hedgehog (SHH)

Tag tag free
Expression Host E. coli

Purified recombinant protein of Human sonic hedgehog (SHH)

Tag tag free
Expression Host E. coli

Purified recombinant protein of Human sonic hedgehog (SHH)

Tag tag free
Expression Host E. coli

Purified recombinant protein of Human sonic hedgehog (SHH)

Tag tag free
Expression Host E. coli

Purified recombinant protein of Human sonic hedgehog (SHH)

Tag tag free
Expression Host E. coli

Purified recombinant protein of Human sonic hedgehog (SHH)

Tag tag free
Expression Host E. coli

Transient overexpression of SHH (NM_000193) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of SHH (NM_000193) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack