Products

cDNA Clones (49)
Proteins (21)
Antibodies (6)
Jump to Filters
View as table Download
Angiotensin II Type 1 Receptor (AGTR1) Rabbit Polyclonal Antibody
TA328665

USD 585.00

2 Weeks

Rabbit Polyclonal Anti-Angiotensin II Receptor Type-1 (extracellular)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide NSSTEDGIKRIQDDC, corresponding to amino acid residues 4-18 of human AT1 receptor. Extracellular, N-terminus.
Angiotensin II Type 1 Receptor (AGTR1) (NM_009585) Human Tagged ORF Clone Lentiviral Particle
RC205162L3V

USD 820.00

7 Weeks

Lenti ORF particles, AGTR1 (Myc-DDK tagged) - Human angiotensin II receptor, type 1 (AGTR1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Angiotensin II Type 1 Receptor (AGTR1) (NM_009585) Human Tagged ORF Clone Lentiviral Particle
RC205162L4V

USD 820.00

3 Weeks

Lenti ORF particles, AGTR1 (mGFP-tagged) - Human angiotensin II receptor, type 1 (AGTR1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Angiotensin II Type 1 Receptor (AGTR1) (NM_004835) Human Tagged ORF Clone Lentiviral Particle
RC209773L3V

USD 820.00

5 Weeks

Lenti ORF particles, AGTR1 (Myc-DDK tagged) - Human angiotensin II receptor, type 1 (AGTR1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Angiotensin II Type 1 Receptor (AGTR1) (NM_004835) Human Tagged ORF Clone Lentiviral Particle
RC209773L4V

USD 820.00

7 Weeks

Lenti ORF particles, AGTR1 (mGFP-tagged) - Human angiotensin II receptor, type 1 (AGTR1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Angiotensin II Type 1 Receptor (AGTR1) (NM_000685) Human Tagged ORF Clone Lentiviral Particle
RC212008L3V

USD 820.00

5 Weeks

Lenti ORF particles, AGTR1 (Myc-DDK tagged) - Human angiotensin II receptor, type 1 (AGTR1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Angiotensin II Type 1 Receptor (AGTR1) (NM_000685) Human Tagged ORF Clone Lentiviral Particle
RC212008L4V

USD 820.00

In Stock

Lenti ORF particles, AGTR1 (mGFP-tagged) - Human angiotensin II receptor, type 1 (AGTR1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Angiotensin II Type 1 Receptor (AGTR1) (NM_031850) Human Tagged ORF Clone Lentiviral Particle
RC212171L3V

USD 820.00

5 Weeks

Lenti ORF particles, AGTR1 (Myc-DDK tagged) - Human angiotensin II receptor, type 1 (AGTR1), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Angiotensin II Type 1 Receptor (AGTR1) (NM_031850) Human Tagged ORF Clone Lentiviral Particle
RC212171L4V

USD 820.00

7 Weeks

Lenti ORF particles, AGTR1 (mGFP-tagged) - Human angiotensin II receptor, type 1 (AGTR1), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Angiotensin II Type 1 Receptor (AGTR1) (NM_032049) Human Tagged ORF Clone Lentiviral Particle
RC216447L3V

USD 820.00

6 Weeks

Lenti ORF particles, AGTR1 (Myc-DDK tagged) - Human angiotensin II receptor, type 1 (AGTR1), transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Angiotensin II Type 1 Receptor (AGTR1) (NM_032049) Human Tagged ORF Clone Lentiviral Particle
RC216447L4V

USD 820.00

6 Weeks

Lenti ORF particles, AGTR1 (mGFP-tagged) - Human angiotensin II receptor, type 1 (AGTR1), transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Angiotensin II Type 1 Receptor (AGTR1) (NM_032049) Human Over-expression Lysate
LY429794

USD 396.00

5 Days

Transient overexpression lysate of angiotensin II receptor, type 1 (AGTR1), transcript variant 5

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Angiotensin II Type 1 Receptor (AGTR1) Rabbit Polyclonal Antibody
TA306839

USD 430.00

2 Weeks

Rabbit Polyclonal AGTR1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen AGTR1 antibody was raised against a 16 amino acid peptide from near the center of human AGTR1.
Angiotensin II Type 1 Receptor (AGTR1) (NM_000685) Human Tagged ORF Clone
RC212008L1

USD 768.00

In Stock

Lenti ORF clone of Human angiotensin II receptor, type 1 (AGTR1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Angiotensin II Type 1 Receptor (AGTR1) (NM_032049) Human Tagged ORF Clone
RC216447L1

USD 768.00

In Stock

Lenti ORF clone of Human angiotensin II receptor, type 1 (AGTR1), transcript variant 5, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Angiotensin II Type 1 Receptor (AGTR1) Rabbit Polyclonal Antibody
TA346383

USD 475.00

2 Weeks

Rabbit Polyclonal Anti-AGTR1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-AGTR1 antibody: synthetic peptide directed towards the N terminal of human AGTR1. Synthetic peptide located within the following region: ILNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVI
Angiotensin II Type 1 Receptor (AGTR1) Goat Polyclonal Antibody
TA303151

USD 375.00

In Stock

Goat Polyclonal Antibody against AGTR1

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-EIQKNKPRNDDIFK, from the internal region of the protein sequence according to NP_000676.1; NP_004826.2; NP_033611.1; NP_114038.1; NP_114438.1.