Germany
Japan
United Kingdom
China
CXCR6 (GFP-tagged) - Human chemokine (C-X-C motif) receptor 6 (CXCR6)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table DownloadCXCR6 (Myc-DDK-tagged)-Human chemokine (C-X-C motif) receptor 6 (CXCR6)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, CXCR6 (Myc-DDK tagged) - Human chemokine (C-X-C motif) receptor 6 (CXCR6), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, CXCR6 (mGFP-tagged) - Human chemokine (C-X-C motif) receptor 6 (CXCR6), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF clone of Human chemokine (C-X-C motif) receptor 6 (CXCR6), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CXCR6 (Myc-DDK tagged) - Human chemokine (C-X-C motif) receptor 6 (CXCR6), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human chemokine (C-X-C motif) receptor 6 (CXCR6), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CXCR6 (mGFP-tagged) - Human chemokine (C-X-C motif) receptor 6 (CXCR6), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human chemokine (C-X-C motif) receptor 6 (CXCR6), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
CXCR6 (untagged)-Human chemokine (C-X-C motif) receptor 6 (CXCR6)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Bonzo Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Bonzo antibody was raised against a peptide corresponding to amino acids near the amino terminus of human Bonzo/STRL33. The sequence of this peptide differs from those of African green monkey and pig-tailed macaque by one or two amino acids, respectively,. |
Lenti ORF clone of Human chemokine (C-X-C motif) receptor 6 (CXCR6), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Bonzo Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Bonzo antibody was raised against a peptide corresponding to amino acids 319 to 338 of human origin. The sequence of this peptide is identical to those of macaque and African green monkey. |
Goat Anti-CXCR6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SEDNSKTFSASHN, from the C Terminus of the protein sequence according to NP_006555.1. |
Rabbit Polyclonal Anti-CXCR6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CXCR6 antibody: synthetic peptide directed towards the N terminal of human CXCR6. Synthetic peptide located within the following region: AEHDYHEDYGFSSFNDSSQEEHQDFLQFSKVFLPCMYLVVFVCGLVGNSL |
Transient overexpression of CXCR6 (NM_006564) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CXCR6 (NM_006564) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CXCR6 (NM_006564) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- CXCR6
Families
- GPCR
Pathways
- Cytokine-cytokine receptor interaction