Products

cDNA Clones (20)
Proteins (8)
Antibodies (5)
Jump to Filters
View as table Download
Adenosine A1 Receptor (ADORA1) (NM_000674) Human Tagged ORF Clone
RG222013

USD 460.00

In Stock

ADORA1 (GFP-tagged) - Human adenosine A1 receptor (ADORA1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Adenosine A1 Receptor (ADORA1) (NM_000674) Human Tagged ORF Clone
RC222013

USD 420.00

In Stock

ADORA1 (Myc-DDK-tagged)-Human adenosine A1 receptor (ADORA1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Adenosine A1 Receptor (ADORA1) (NM_000674) Human Untagged Clone
SC119756

USD 310.00

In Stock

ADORA1 (untagged)-Human adenosine A1 receptor (ADORA1), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
Adenosine A1 Receptor (ADORA1) (NM_001048230) Human Tagged ORF Clone Lentiviral Particle
RC205381L3V

USD 820.00

5 Weeks

Lenti ORF particles, ADORA1 (Myc-DDK tagged) - Human adenosine A1 receptor (ADORA1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Adenosine A1 Receptor (ADORA1) (NM_001048230) Human Tagged ORF Clone Lentiviral Particle
RC205381L4V

USD 820.00

7 Weeks

Lenti ORF particles, ADORA1 (mGFP-tagged) - Human adenosine A1 receptor (ADORA1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Adenosine A1 Receptor (ADORA1) (NM_000674) Human Tagged ORF Clone Lentiviral Particle
RC222013L3V

USD 820.00

6 Weeks

Lenti ORF particles, ADORA1 (Myc-DDK tagged) - Human adenosine A1 receptor (ADORA1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Adenosine A1 Receptor (ADORA1) (NM_000674) Human Tagged ORF Clone Lentiviral Particle
RC222013L4V

USD 820.00

6 Weeks

Lenti ORF particles, ADORA1 (mGFP-tagged) - Human adenosine A1 receptor (ADORA1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Adenosine A1 Receptor (ADORA1) Rabbit Polyclonal Antibody
TA328694

USD 585.00

2 Weeks

Rabbit Polyclonal Anti-A1 Adenosine Receptor

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)KKVSASSGDPQKYYGKE, corresponding to amino acid residues 213-229 of human A1AR. 3rd intracellular loop.
Adenosine A1 Receptor (ADORA1) (NM_000674) Human Tagged ORF Clone
RC222013L2

USD 620.00

3 Weeks

Lenti ORF clone of Human adenosine A1 receptor (ADORA1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Adenosine A1 Receptor (ADORA1) Rabbit Polyclonal Antibody
TA313432

USD 345.00

In Stock

Rabbit polyclonal anti-ADORA1 antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human ADORA1.
Adenosine A1 Receptor (ADORA1) (NM_001048230) Human Over-expression Lysate
LY420792

USD 396.00

5 Days

Transient overexpression lysate of adenosine A1 receptor (ADORA1), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Adenosine A1 Receptor (ADORA1) Rabbit Polyclonal Antibody
TA341026

USD 425.00

5 Days

Rabbit Polyclonal Anti-ADORA1 Antibody (Extracellular Domain)

Applications IHC
Reactivities Human
Immunogen ADORA1 / Adenosine A1 Receptor antibody was raised against synthetic 20 amino acid peptide from 2nd extracellular domain of human Adenosine A1 Receptor. Percent identity with other species by BLAST analysis: Human, Orangutan, Monkey (100%); Gibbon, Marmoset, Mouse, Rat, Hamster, Elephant, Dog, Bat, Horse, Rabbit, Guinea pig (95%); Panda, Pig (90%); Bovine (85%).
Adenosine A1 Receptor (ADORA1) Rabbit Polyclonal Antibody
TA342789

USD 375.00

5 Days

Rabbit Polyclonal Anti-ADORA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ADORA1 antibody: synthetic peptide directed towards the C terminal of human ADORA1. Synthetic peptide located within the following region: THGNSAMNPIVYAFRIQKFRVTFLKIWNDHFRCQPAPPIDEDLPEERPDD
Adenosine A1 Receptor (ADORA1) Rabbit Polyclonal Antibody
TA342790

USD 375.00

5 Days

Rabbit Polyclonal Anti-ADORA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ADORA1 antibody: synthetic peptide directed towards the C terminal of human ADORA1. Synthetic peptide located within the following region: VLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLAL
Adenosine A1 Receptor (ADORA1) ICC Control Block
TB405381

USD 1,070.00

4 Weeks

Transient overexpression of ADORA1 (NM_001048230) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Adenosine A1 Receptor (ADORA1) ICC Control Block
TB422013

USD 1,070.00

4 Weeks

Transient overexpression of ADORA1 (NM_000674) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Adenosine A1 Receptor (ADORA1) Cytosection
TS405381

USD 225.00

4 Weeks

Transient overexpression of ADORA1 (NM_001048230) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Adenosine A1 Receptor (ADORA1) Cytosection
TS405381P5

USD 889.00

4 Weeks

Transient overexpression of ADORA1 (NM_001048230) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Adenosine A1 Receptor (ADORA1) Cytosection
TS422013

USD 225.00

4 Weeks

Transient overexpression of ADORA1 (NM_000674) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Adenosine A1 Receptor (ADORA1) Cytosection
TS422013P5

USD 889.00

4 Weeks

Transient overexpression of ADORA1 (NM_000674) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack