Products

cDNA Clones (10)
Antibodies (5)
Proteins (5)
Jump to Filters
View as table Download
Adenosine A2b Receptor (ADORA2B) (NM_000676) Human Tagged ORF Clone Lentiviral Particle
RC206623L3V

USD 820.00

5 Weeks

Lenti ORF particles, ADORA2B (Myc-DDK tagged) - Human adenosine A2b receptor (ADORA2B), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Adenosine A2b Receptor (ADORA2B) Rabbit Polyclonal Antibody
TA349146

USD 484.00

5 Days

Rabbit Polyclonal Anti-ADORA2B Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ADORA2B antibody was raised against a 19 amino acid peptide near the carboxy terminus of human ADORA2B. The immunogen is located within the last 50 amino acids of ADORA2B.
Adenosine A2b Receptor (ADORA2B) Rabbit Polyclonal Antibody
TA328605

USD 585.00

3 Weeks

Rabbit Polyclonal Anti-A2B Adenosine Receptor (extracellular)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Peptide KDSATNN*STEPWDGTTNESC, corresponding to amino acid residues 147-166 of human A2B Adenosine Receptor with replacement of cysteine 154 (C154) with serine (*S). 2nd extracellular loop.
Adenosine A2b Receptor (ADORA2B) Goat Polyclonal Antibody
TA305620

USD 375.00

5 Days

Goat Anti-Adenosine A2b Receptor Antibody

Applications FC, IF, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CQADVKSGNGQ, from the C Terminus of the protein sequence according to NP_000667.1.
Adenosine A2b Receptor (ADORA2B) Rabbit Polyclonal Antibody
TA340987

USD 425.00

5 Days

Rabbit Polyclonal Anti-ADORA2B Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen ADORA2B/Adenosine A2B Receptor antibody was raised against synthetic 16 amino acid peptide from internal region of human Adenosine A2b Receptor. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey, Marmoset, Horse (94%); Rabbit (88%); Dog (81%).
Adenosine A2b Receptor (ADORA2B) Rabbit Polyclonal Antibody
TA342791

USD 375.00

5 Days

Rabbit Polyclonal Anti-ADORA2B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ADORA2B antibody: synthetic peptide directed towards the C terminal of human ADORA2B. Synthetic peptide located within the following region: AKSLAMIVGIFALCWLPVHAVNCVTLFQPAQGKNKPKWAMNMAILLSHAN
Adenosine A2b Receptor (ADORA2B) (NM_000676) ICC Control Block
TB406623

USD 1,070.00

4 Weeks

Transient overexpression of ADORA2B (NM_000676) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Adenosine A2b Receptor (ADORA2B) Cytosection
TS406623

USD 225.00

4 Weeks

Transient overexpression of ADORA2B (NM_000676) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Adenosine A2b Receptor (ADORA2B) Cytosection
TS406623P5

USD 889.00

4 Weeks

Transient overexpression of ADORA2B (NM_000676) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack