Products

cDNA Clones (21)
Proteins (10)
Antibodies (8)
Jump to Filters
View as table Download
CCR2 (NM_000647) Human Tagged ORF Clone
RC221234

USD 420.00

In Stock

CCR2 (Myc-DDK-tagged)-Human chemokine (C-C motif) receptor 2 (CCR2), transcript variant A

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CCR2 (NM_000648) Human Tagged ORF Clone
RC221283

USD 420.00

In Stock

CCR2 (Myc-DDK-tagged)-Human chemokine (C-C motif) receptor 2 (CCR2), transcript variant B

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CCR2 (NM_000647) Human Tagged ORF Clone Lentiviral Particle
RC221234L1V

USD 820.00

3 Weeks

Lenti ORF particles, CCR2 (Myc-DDK tagged) - Human chemokine (C-C motif) receptor 2 (CCR2), transcript variant A, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
CCR2 (NM_000647) Human Tagged ORF Clone Lentiviral Particle
RC221234L2V

USD 820.00

6 Weeks

Lenti ORF particles, CCR2 (mGFP-tagged) - Human chemokine (C-C motif) receptor 2 (CCR2), transcript variant A, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
CCR2 (NM_000648) Human Tagged ORF Clone Lentiviral Particle
RC221283L1V

USD 820.00

3 Weeks

Lenti ORF particles, CCR2 (Myc-DDK tagged) - Human chemokine (C-C motif) receptor 2 (CCR2), transcript variant B, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
CCR2 (NM_000648) Human Tagged ORF Clone Lentiviral Particle
RC221283L2V

USD 820.00

6 Weeks

Lenti ORF particles, CCR2 (mGFP-tagged) - Human chemokine (C-C motif) receptor 2 (CCR2), transcript variant B, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
CCR2 (NM_000647) Human Tagged ORF Clone
RG221234

USD 460.00

In Stock

CCR2 (GFP-tagged) - Human chemokine (C-C motif) receptor 2 (CCR2), transcript variant A

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CCR2 (NM_000648) Human Tagged ORF Clone
RG221283

USD 460.00

In Stock

CCR2 (GFP-tagged) - Human chemokine (C-C motif) receptor 2 (CCR2), transcript variant B

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CCR2 (NM_000647) Human Tagged ORF Clone
RC221234L3

USD 620.00

3 Weeks

Lenti ORF clone of Human chemokine (C-C motif) receptor 2 (CCR2), transcript variant A, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CCR2 (NM_000647) Human Tagged ORF Clone Lentiviral Particle
RC221234L3V

USD 820.00

5 Weeks

Lenti ORF particles, CCR2 (Myc-DDK tagged) - Human chemokine (C-C motif) receptor 2 (CCR2), transcript variant A, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CCR2 (NM_000647) Human Tagged ORF Clone
RC221234L4

USD 620.00

3 Weeks

Lenti ORF clone of Human chemokine (C-C motif) receptor 2 (CCR2), transcript variant A, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CCR2 (NM_000647) Human Tagged ORF Clone Lentiviral Particle
RC221234L4V

USD 820.00

7 Weeks

Lenti ORF particles, CCR2 (mGFP-tagged) - Human chemokine (C-C motif) receptor 2 (CCR2), transcript variant A, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CCR2 (NM_000648) Human Tagged ORF Clone
RC221283L3

USD 620.00

3 Weeks

Lenti ORF clone of Human chemokine (C-C motif) receptor 2 (CCR2), transcript variant B, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CCR2 (NM_000648) Human Tagged ORF Clone Lentiviral Particle
RC221283L3V

USD 820.00

5 Weeks

Lenti ORF particles, CCR2 (Myc-DDK tagged) - Human chemokine (C-C motif) receptor 2 (CCR2), transcript variant B, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CCR2 (NM_000648) Human Tagged ORF Clone
RC221283L4

USD 620.00

3 Weeks

Lenti ORF clone of Human chemokine (C-C motif) receptor 2 (CCR2), transcript variant B, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CCR2 (NM_000648) Human Tagged ORF Clone Lentiviral Particle
RC221283L4V

USD 820.00

7 Weeks

Lenti ORF particles, CCR2 (mGFP-tagged) - Human chemokine (C-C motif) receptor 2 (CCR2), transcript variant B, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CCR2 (NM_000648) Human Untagged Clone
SC109082

USD 680.00

In Stock

CCR2 (untagged)-Human chemokine (C-C motif) receptor 2 (CCR2), transcript variant B

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
CCR2 (NM_000647) Human Tagged Lenti ORF Clone
RC221234L1

USD 768.00

In Stock

Lenti ORF clone of Human chemokine (C-C motif) receptor 2 (CCR2), transcript variant A, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
CCR2 (NM_000648) Human Tagged ORF Clone
RC221283L1

USD 768.00

In Stock

Lenti ORF clone of Human chemokine (C-C motif) receptor 2 (CCR2), transcript variant B, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
CCR2 (NM_000648) Human Over-expression Lysate
LY400217

USD 396.00

In Stock

Transient overexpression lysate of chemokine (C-C motif) receptor 2 (CCR2), transcript variant B

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CCR2 Rabbit Polyclonal Antibody
TA336782

USD 424.00

5 Days

Rabbit Polyclonal CCR2 Antibody

Applications FC, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide made to an N-terminal portion of the human CCR2 protein (within residues 20-100). [Swiss-Prot# P00338]
CCR2 Rabbit Polyclonal Antibody
TA344354

USD 475.00

2 Weeks

Rabbit Polyclonal Anti-CCR2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CCR2 antibody: synthetic peptide directed towards the middle region of human CCR2. Synthetic peptide located within the following region: LIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMIVYFLFWTPYNIVILL
CCR2 Rabbit Polyclonal Antibody
TA340622

USD 425.00

2 Weeks

Rabbit Polyclonal Anti-CCR2 Antibody (N-Terminus)

Applications IHC
Reactivities Tested: Human
Immunogen CCR2 antibody was raised against synthetic 20 amino acid peptide from N-terminal extracellular domain of human CCR2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%).
CCR2 Rabbit Polyclonal Antibody
TA590046

USD 409.00

In Stock

Rabbit Polyclonal CCR2 Antibody

Applications ELISA, WB
Reactivities Human
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.
CCR2 (NM_000647) Human Tagged ORF Clone
RC221234L2

USD 620.00

3 Weeks

Lenti ORF clone of Human chemokine (C-C motif) receptor 2 (CCR2), transcript variant A, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
CCR2 (NM_000648) Human Tagged ORF Clone
RC221283L2

USD 620.00

3 Weeks

Lenti ORF clone of Human chemokine (C-C motif) receptor 2 (CCR2), transcript variant B, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
CCR2 Rabbit Polyclonal Antibody
TA336783

USD 457.00

5 Days

Rabbit Polyclonal CCR2 Antibody

Applications FC
Reactivities Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide made to an N-terminal portion of the mouse CCR2 protein (within residues 20-100). [Swiss-Prot# P51683]
CCR2 (NM_000647) Human Over-expression Lysate
LY424596

USD 396.00

5 Days

Transient overexpression lysate of chemokine (C-C motif) receptor 2 (CCR2), transcript variant A

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CCR2 Rabbit Polyclonal Antibody
TA341370

USD 425.00

5 Days

Rabbit Polyclonal Anti-CCR2 Antibody (Extracellular Domain)

Applications IHC
Reactivities Tested: Human; Predicted: Monkey
Immunogen CCR2 antibody was raised against synthetic 20 amino acid peptide from 2nd extracellular domain of human CCR2. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon (95%); Monkey (90%).
CCR2 (NM_000648) Human Over-expression Lysate
LC400217

USD 121.00

2 Weeks

CCR2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
CCR2 (NM_000647) Human Over-expression Lysate
LC424596

USD 121.00

2 Weeks

CCR2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CCR2 Rabbit Polyclonal Antibody
TA350635

USD 345.00

In Stock

Rabbit Polyclonal Anti-CCR2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CCR2
CCR2 Rabbit Polyclonal Antibody
TA357444

USD 360.00

5 Days

CCR2 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
CCR2 (NM_000647) ICC Control Block
TB421234

USD 1,070.00

4 Weeks

Transient overexpression of CCR2 (NM_000647) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CCR2 (NM_000648) ICC Control Block
TB421283

USD 1,070.00

4 Weeks

Transient overexpression of CCR2 (NM_000648) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CCR2 Cytosection
TS421234

USD 225.00

4 Weeks

Transient overexpression of CCR2 (NM_000647) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

CCR2 ICC Control Sections
TS421234P5

USD 889.00

4 Weeks

Transient overexpression of CCR2 (NM_000647) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

CCR2 Cytosection
TS421283

USD 225.00

4 Weeks

Transient overexpression of CCR2 (NM_000648) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

CCR2 ICC Control Sections
TS421283P5

USD 889.00

4 Weeks

Transient overexpression of CCR2 (NM_000648) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack