Products

cDNA Clones (18)
Proteins (8)
Antibodies (2)
Jump to Filters
View as table Download
CCRL2 (NM_001130910) Human Tagged ORF Clone
RC225528

USD 420.00

In Stock

CCRL2 (Myc-DDK-tagged)-Human chemokine (C-C motif) receptor-like 2 (CCRL2), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CCRL2 (NM_001130910) Human Tagged ORF Clone Lentiviral Particle
RC225528L1V

USD 820.00

3 Weeks

Lenti ORF particles, CCRL2 (Myc-DDK tagged) - Human chemokine (C-C motif) receptor-like 2 (CCRL2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
CCRL2 (NM_001130910) Human Tagged ORF Clone Lentiviral Particle
RC225528L2V

USD 820.00

6 Weeks

Lenti ORF particles, CCRL2 (mGFP-tagged) - Human chemokine (C-C motif) receptor-like 2 (CCRL2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
CCRL2 (NM_001130910) Human Tagged ORF Clone
RG225528

USD 460.00

In Stock

CCRL2 (GFP-tagged) - Human chemokine (C-C motif) receptor-like 2 (CCRL2), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CCRL2 (NM_003965) Human Tagged ORF Clone
RC218484

USD 420.00

In Stock

CCRL2 (Myc-DDK-tagged)-Human chemokine (C-C motif) receptor-like 2 (CCRL2), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CCRL2 (NM_003965) Human Tagged ORF Clone
RG218484

USD 460.00

In Stock

CCRL2 (GFP-tagged) - Human chemokine (C-C motif) receptor-like 2 (CCRL2), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CCRL2 (NM_003965) Human Tagged ORF Clone
RC218484L3

USD 620.00

3 Weeks

Lenti-ORF clone of CCRL2 (Myc-DDK-tagged)-Human chemokine (C-C motif) receptor-like 2 (CCRL2), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CCRL2 (NM_003965) Human Tagged ORF Clone Lentiviral Particle
RC218484L3V

USD 820.00

6 Weeks

Lenti ORF particles, CCRL2 (Myc-DDK-tagged)-Human chemokine (C-C motif) receptor-like 2 (CCRL2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CCRL2 (NM_003965) Human Tagged ORF Clone
RC218484L4

USD 620.00

3 Weeks

Lenti-ORF clone of CCRL2 (mGFP-tagged)-Human chemokine (C-C motif) receptor-like 2 (CCRL2), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CCRL2 (NM_003965) Human Tagged ORF Clone Lentiviral Particle
RC218484L4V

USD 820.00

6 Weeks

Lenti ORF particles, CCRL2 (mGFP-tagged)-Human chemokine (C-C motif) receptor-like 2 (CCRL2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CCRL2 (NM_001130910) Human Tagged ORF Clone
RC225528L3

USD 620.00

3 Weeks

Lenti ORF clone of Human chemokine (C-C motif) receptor-like 2 (CCRL2), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CCRL2 (NM_001130910) Human Tagged ORF Clone Lentiviral Particle
RC225528L3V

USD 820.00

6 Weeks

Lenti ORF particles, CCRL2 (Myc-DDK tagged) - Human chemokine (C-C motif) receptor-like 2 (CCRL2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CCRL2 (NM_001130910) Human Tagged ORF Clone
RC225528L4

USD 620.00

3 Weeks

Lenti ORF clone of Human chemokine (C-C motif) receptor-like 2 (CCRL2), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CCRL2 (NM_001130910) Human Tagged ORF Clone Lentiviral Particle
RC225528L4V

USD 820.00

6 Weeks

Lenti ORF particles, CCRL2 (mGFP-tagged) - Human chemokine (C-C motif) receptor-like 2 (CCRL2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CCRL2 (NM_001130910) Human Untagged Clone
SC325815

USD 610.00

In Stock

CCRL2 (untagged)-Human chemokine (C-C motif) receptor-like 2 (CCRL2), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
CCRL2 (NM_001130910) Human Tagged ORF Clone
RC225528L1

USD 620.00

In Stock

Lenti ORF clone of Human chemokine (C-C motif) receptor-like 2 (CCRL2), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
CCRL2 (NM_001130910) Human Tagged ORF Clone
RC225528L2

USD 620.00

3 Weeks

Lenti ORF clone of Human chemokine (C-C motif) receptor-like 2 (CCRL2), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
CCRL2 (NM_003965) Human Untagged Clone
SC117661

USD 760.00

In Stock

CCRL2 (untagged)-Human chemokine (C-C motif) receptor-like 2 (CCRL2), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
CCRL2 (NM_001130910) Human Over-expression Lysate
LC427300

USD 121.00

In Stock

CCRL2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CCRL2 (NM_001130910) Human Over-expression Lysate
LY427300

USD 396.00

In Stock

Transient overexpression lysate of chemokine (C-C motif) receptor-like 2 (CCRL2), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CCRL2 (Center) Rabbit Polyclonal Antibody
AP50828PU-N

USD 450.00

2 Weeks

CCRL2 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 205-234 amino acids from the Central region of human CCRL2
CCRL2 Rabbit Polyclonal Antibody
TA334723

USD 375.00

5 Days

Rabbit Polyclonal Anti-CCRL2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CCRL2 antibody: synthetic peptide directed towards the N terminal of human CCRL2. Synthetic peptide located within the following region: LSAQLVPSLCSAVFVIGVLDNLLVVLILVKYKGLKRVENIYLLNLAVSNL
CCRL2 (NM_003965) ICC Control Block
TB418484

USD 1,070.00

4 Weeks

Transient overexpression of CCRL2 (NM_003965) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CCRL2 (NM_001130910) ICC Control Block
TB425528

USD 1,070.00

4 Weeks

Transient overexpression of CCRL2 (NM_001130910) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CCRL2 Cytosection
TS418484

USD 225.00

4 Weeks

Transient overexpression of CCRL2 (NM_003965) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

CCRL2 Cytosection
TS418484P5

USD 889.00

4 Weeks

Transient overexpression of CCRL2 (NM_003965) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

CCRL2 Cytosection
TS425528

USD 225.00

4 Weeks

Transient overexpression of CCRL2 (NM_001130910) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

CCRL2 Cytosection
TS425528P5

USD 889.00

4 Weeks

Transient overexpression of CCRL2 (NM_001130910) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack