FZD5 (Myc-DDK-tagged)-Human frizzled family receptor 5 (FZD5)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
FZD5 (Myc-DDK-tagged)-Human frizzled family receptor 5 (FZD5)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 940.00
3 Weeks
Lenti ORF particles, FZD5 (Myc-DDK tagged) - Human frizzled family receptor 5 (FZD5), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 940.00
3 Weeks
Lenti ORF particles, FZD5 (mGFP-tagged) - Human frizzled family receptor 5 (FZD5), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
FZD5 (GFP-tagged) - Human frizzled family receptor 5 (FZD5)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human frizzled family receptor 5 (FZD5), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 940.00
5 Weeks
Lenti ORF particles, FZD5 (Myc-DDK tagged) - Human frizzled family receptor 5 (FZD5), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human frizzled family receptor 5 (FZD5), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 940.00
5 Weeks
Lenti ORF particles, FZD5 (mGFP-tagged) - Human frizzled family receptor 5 (FZD5), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
FZD5 (untagged)-Human frizzled family receptor 5 (FZD5)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human frizzled family receptor 5 (FZD5), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Rabbit polyclonal anti-FZD5 antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FZD5. |
Rabbit Polyclonal Anti-FZD5 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FZD5 antibody: synthetic peptide directed towards the middle region of human FZD5. Synthetic peptide located within the following region: CYLYEQHYRESWEAALTCACPGHDTGQPRAKPEYWVLMLKYFMCLVVGIT |
Rabbit Polyclonal Anti-FZD5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FZD5 antibody: synthetic peptide directed towards the C terminal of human FZD5. Synthetic peptide located within the following region: SRCCCRPRRGHKSGGAMAAGDYPEASAALTGRTGPPGPAATYHKQVSLSH |
FZD5 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Rabbit polyclonal anti-FZD5 antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FZD5. |
Transient overexpression lysate of frizzled homolog 5 (Drosophila) (FZD5)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression of FZD5 (NM_003468) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of FZD5 (NM_003468) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of FZD5 (NM_003468) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack