Products

Antibodies (9)
cDNA Clones (9)
Proteins (5)
Jump to Filters
View as table Download
Metabotropic Glutamate Receptor 3 (GRM3) (NM_000840) Human Tagged ORF Clone Lentiviral Particle
RC207379L3V

USD 1,150.00

5 Weeks

Lenti ORF particles, GRM3 (Myc-DDK tagged) - Human glutamate receptor, metabotropic 3 (GRM3), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Metabotropic Glutamate Receptor 3 (GRM3) (NM_000840) Human Tagged ORF Clone Lentiviral Particle
RC207379L4V

USD 1,150.00

3 Weeks

Lenti ORF particles, GRM3 (mGFP-tagged) - Human glutamate receptor, metabotropic 3 (GRM3), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Metabotropic Glutamate Receptor 3 (GRM3) Rabbit Polyclonal Antibody
TA313973

USD 345.00

In Stock

Rabbit polyclonal anti-GluR2/3 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human GluR2/3.
Metabotropic Glutamate Receptor 3 (GRM3) Rabbit Polyclonal Antibody
TA332547

USD 275.00

3 Weeks

Rabbit anti-GRM3 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human GRM3
Metabotropic Glutamate Receptor 3 (GRM3) Rabbit Polyclonal Antibody
TA348028

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-GluR2/3 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GluR2/3 Antibody: A synthesized peptide derived from human GluR2/3
Metabotropic Glutamate Receptor 3 (GRM3) Rabbit Polyclonal Antibody
TA342668

USD 375.00

5 Days

Rabbit Polyclonal Anti-GRM3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GRM3 antibody is: synthetic peptide directed towards the N-terminal region of Human GRM3. Synthetic peptide located within the following region: NHRNPWFRDFWEQKFQCSLQNKRNHRRVCDKHLAIDSSNYEQESKIMFVV
Metabotropic Glutamate Receptor 3 (GRM3) Rabbit Polyclonal Antibody
TA342669

USD 375.00

5 Days

Rabbit Polyclonal Anti-GRM3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GRM3 antibody is: synthetic peptide directed towards the C-terminal region of HUMAN GRM3. Synthetic peptide located within the following region: RDFWEQKFQCSLQNKRNHRRVCDKHLAIDSSNYEQESKIMFVVNAVYAMA
Metabotropic Glutamate Receptor 3 (GRM3) Rabbit Polyclonal Antibody
TA321211

USD 345.00

In Stock

Anti-GRM3 Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 23-276 amino acids of human glutamate receptor, metabotropic 3
Metabotropic Glutamate Receptor 3 (GRM3) Rabbit Polyclonal Antibody
TA321212

USD 345.00

In Stock

Anti-GRM3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 23-276 amino acids of human glutamate receptor, metabotropic 3
Metabotropic Glutamate Receptor 3 (GRM3) Rabbit Polyclonal Antibody
TA321213

USD 345.00

In Stock

Anti-GRM3 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 366-380 amino acids of Human glutamate receptor, metabotropic 3
Metabotropic Glutamate Receptor 3 (GRM3) Rabbit Polyclonal Antibody
TA321214

USD 345.00

In Stock

Anti-GRM3 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 366-380 amino acids of Human glutamate receptor, metabotropic 3
Metabotropic Glutamate Receptor 3 (GRM3) ICC Control Block
TB407379

USD 1,400.00

4 Weeks

Transient overexpression of GRM3 (NM_000840) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Metabotropic Glutamate Receptor 3 (GRM3) Cytosection
TS407379

USD 225.00

4 Weeks

Transient overexpression of GRM3 (NM_000840) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Metabotropic Glutamate Receptor 3 (GRM3) Cytosection
TS407379P5

USD 889.00

4 Weeks

Transient overexpression of GRM3 (NM_000840) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack