Products

cDNA Clones (11)
Antibodies (6)
Proteins (3)
Jump to Filters
View as table Download
MAS1 (NM_002377) Human Tagged ORF Clone
RC224124

USD 420.00

In Stock

MAS1 (Myc-DDK-tagged)-Human MAS1 oncogene (MAS1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
MAS1 (NM_002377) Human Tagged ORF Clone
RG224124

USD 460.00

In Stock

MAS1 (GFP-tagged) - Human MAS1 oncogene (MAS1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
MAS1 (NM_002377) Human Tagged ORF Clone
RC224124L4

USD 620.00

In Stock

Lenti ORF clone of Human MAS1 oncogene (MAS1), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
MAS1 (NM_002377) Human Untagged Clone
SC118704

USD 660.00

In Stock

MAS1 (untagged)-Human MAS1 oncogene (MAS1)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
MAS1 (NM_002377) Human Tagged ORF Clone
RC224124L1

USD 768.00

In Stock

Lenti ORF clone of Human MAS1 oncogene (MAS1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
MAS1 Rabbit Polyclonal Antibody
TA309741

USD 424.00

In Stock

Rabbit Polyclonal MAS1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Primate, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human MAS1 protein (between residues 75-125) [UniProt P04201]
MAS1 (NM_002377) Human Tagged ORF Clone
RC224124L3

USD 768.00

3 Weeks

Lenti ORF clone of Human MAS1 oncogene (MAS1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
MAS1 (NM_002377) Human Tagged ORF Clone
RC224124L2

USD 620.00

3 Weeks

Lenti ORF clone of Human MAS1 oncogene (MAS1), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
MAS1 Rabbit Polyclonal Antibody
TA339888

USD 375.00

5 Days

Rabbit Polyclonal Anti-MAS1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAS1 antibody: synthetic peptide directed towards the middle region of human MAS1. Synthetic peptide located within the following region: VIIFIAILSFLVFTPLMLVSSTILVVKIRKNTWASHSSKLYIVIMVTIII
MAS1 Rabbit Polyclonal Antibody
TA590691

USD 409.00

In Stock

Rabbit Polyclonal MAS1 Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.
MAS1 Rabbit Polyclonal Antibody
TA339887

USD 310.00

5 Days

Rabbit Polyclonal Anti-MAS1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAS1 antibody: synthetic peptide directed towards the middle region of human MAS1. Synthetic peptide located within the following region: RPKYQSALVCALLWALSCLVTTMEYVMCIDREEESHSRNDCRAVIIFIAI
MAS1 Rabbit Polyclonal Antibody
TA339886

USD 375.00

5 Days

Rabbit Polyclonal Anti-MAS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MAS1 antibody is: synthetic peptide directed towards the N-terminal region of Human MAS1. Synthetic peptide located within the following region: VTSFVVEEPTNISTGRNASVGNAHRQIPIVHWVIMSISPVGFVENGILLW
MAS1 Rabbit Polyclonal Antibody
TA350156

USD 345.00

In Stock

Rabbit Polyclonal Anti-MAS1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human MAS1
MAS1 ICC Control Block
TB424124

USD 1,070.00

4 Weeks

Transient overexpression of MAS1 (NM_002377) in HEK293T cells paraffin embedded controls for ICC/IHC staining

MAS1 Cytosection
TS424124

USD 225.00

4 Weeks

Transient overexpression of MAS1 (NM_002377) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

MAS1 Cytosection
TS424124P5

USD 889.00

4 Weeks

Transient overexpression of MAS1 (NM_002377) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack