MAS1 Rabbit Polyclonal Antibody

CAT#: TA339887

Rabbit Polyclonal Anti-MAS1 Antibody


USD 310.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "MAS1"

Specifications

Product Data
Applications IHC, WB
Recommended Dilution WB, IHC
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-MAS1 antibody: synthetic peptide directed towards the middle region of human MAS1. Synthetic peptide located within the following region: RPKYQSALVCALLWALSCLVTTMEYVMCIDREEESHSRNDCRAVIIFIAI
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 37 kDa
Gene Name MAS1 proto-oncogene, G protein-coupled receptor
Background The structure of MAS1 indicates that it belongs to the class of receptors that are coupled to GTP-binding proteins and share a conserved structural motif, which is described as a '7-transmembrane segment' following the prediction that these hydrophobic segments form membrane-spanning alpha-helices. The MAS1 protein may be a receptor that, when activated, modulates a critical component in a growth-regulating pathway to bring about oncogenic effects.The structure of the MAS1 product indicates that it belongs to the class of receptors that are coupled to GTP-binding proteins and share a conserved structural motif, which is described as a '7-transmembrane segment' following the prediction that these hydrophobic segments form membrane-spanning alpha-helices. The MAS1 protein may be a receptor that, when activated, modulates a critical component in a growth-regulating pathway to bring about oncogenic effects.
Synonyms MAS; MGRA
Note Immunogen Sequence Homology: Human: 100%; Pig: 77%; Rat: 77%; Mouse: 77%; Guinea pig: 77%
Reference Data
Protein Families Druggable Genome, GPCR, Transmembrane
Protein Pathways Neuroactive ligand-receptor interaction, Renin-angiotensin system

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.