Germany
Japan
United Kingdom
China
OPN3 (Myc-DDK-tagged)-Human opsin 3 (OPN3)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
OPN3 (GFP-tagged) - Human opsin 3 (OPN3)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human opsin 3 (OPN3), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, OPN3 (Myc-DDK tagged) - Human opsin 3 (OPN3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human opsin 3 (OPN3), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, OPN3 (mGFP-tagged) - Human opsin 3 (OPN3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Encephalopsin (OPN3) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide corresponding to amino acids 176-220 of Human Encephalopsin. |
Transient overexpression lysate of opsin 3 (OPN3)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
OPN3 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit polyclonal anti-OPN3 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human OPN3. |
Rabbit Polyclonal Anti-OPN3 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Encephalopsin / OPN3 antibody was raised against synthetic 19 amino acid peptide from C-terminus of human OPN3 / Encephalopsin. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey (100%); Dog, Panda (95%); Marmoset, Rat, Elephant (89%); Mouse, Horse (84%). |
Rabbit Polyclonal Anti-OPN3 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Encephalopsin / OPN3 antibody was raised against synthetic 16 amino acid peptide from C-terminus of human OPN3 / Encephalopsin. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Marmoset (94%); Panda (81%). |
Rabbit Polyclonal Anti-OPN3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OPN3 antibody: synthetic peptide directed towards the C terminal of human OPN3. Synthetic peptide located within the following region: IVMSQKDGDRPKKKVTFNSSSIIFIITSDESLSVDDSDKTNGSKVDVIQV |
Transient overexpression of OPN3 (NM_014322) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of OPN3 (NM_014322) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of OPN3 (NM_014322) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- OPN3
Families
- GPCR