Encephalopsin (OPN3) Rabbit Polyclonal Antibody

CAT#: TA342739

Rabbit Polyclonal Anti-OPN3 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "OPN3"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-OPN3 antibody: synthetic peptide directed towards the C terminal of human OPN3. Synthetic peptide located within the following region: IVMSQKDGDRPKKKVTFNSSSIIFIITSDESLSVDDSDKTNGSKVDVIQV
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 45 kDa
Gene Name opsin 3
Background Opsins are members of the guanine nucleotide-binding protein (G protein)-coupled receptor superfamily. In addition to the visual opsins, mammals possess several photoreceptive non-visual opsins that are expressed in extraocular tissues. This gene, opsin 3, is strongly expressed in brain and testis and weakly expressed in liver, placenta, heart, lung, skeletal muscle, kidney, and pancreas. The gene may also be expressed in the retina. The protein has the canonical features of a photoreceptive opsin protein.
Synonyms ECPN; PPP1R116
Note Immunogen Sequence Homology: Human: 100%; Pig: 86%; Horse: 86%; Guinea pig: 86%
Reference Data
Protein Families Druggable Genome, GPCR, Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.