Products

cDNA Clones (23)
Proteins (12)
Antibodies (6)
Jump to Filters
View as table Download
GPR86 (P2RY13) (NM_176894) Human Tagged ORF Clone
RC207883

USD 420.00

In Stock

P2RY13 (Myc-DDK-tagged)-Human purinergic receptor P2Y, G-protein coupled, 13 (P2RY13)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
GPR86 (P2RY13) (NM_023914) Human Tagged ORF Clone
RC217904

USD 420.00

In Stock

P2RY13 (Myc-DDK-tagged)-Human purinergic receptor P2Y, G-protein coupled, 13 (P2RY13), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
GPR86 (P2RY13) (NM_023914) Human Tagged ORF Clone Lentiviral Particle
RC217904L1V

USD 820.00

3 Weeks

Lenti ORF particles, P2RY13 (Myc-DDK tagged) - Human purinergic receptor P2Y, G-protein coupled, 13 (P2RY13), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
GPR86 (P2RY13) (NM_023914) Human Tagged ORF Clone Lentiviral Particle
RC217904L2V

USD 820.00

6 Weeks

Lenti ORF particles, P2RY13 (mGFP-tagged) - Human purinergic receptor P2Y, G-protein coupled, 13 (P2RY13), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
GPR86 (P2RY13) (NM_176894) Human Tagged ORF Clone
RG207883

USD 460.00

In Stock

P2RY13 (GFP-tagged) - Human purinergic receptor P2Y, G-protein coupled, 13 (P2RY13)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GPR86 (P2RY13) (NM_023914) Human Tagged ORF Clone
RG217904

USD 460.00

In Stock

P2RY13 (GFP-tagged) - Human purinergic receptor P2Y, G-protein coupled, 13 (P2RY13), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GPR86 (P2RY13) (NM_176894) Human Tagged ORF Clone
RC207883L3

USD 620.00

3 Weeks

Lenti ORF clone of Human purinergic receptor P2Y, G-protein coupled, 13 (P2RY13), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GPR86 (P2RY13) (NM_176894) Human Tagged ORF Clone Lentiviral Particle
RC207883L3V

USD 820.00

5 Weeks

Lenti ORF particles, P2RY13 (Myc-DDK tagged) - Human purinergic receptor P2Y, G-protein coupled, 13 (P2RY13), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GPR86 (P2RY13) (NM_176894) Human Tagged ORF Clone
RC207883L4

USD 620.00

3 Weeks

Lenti ORF clone of Human purinergic receptor P2Y, G-protein coupled, 13 (P2RY13), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GPR86 (P2RY13) (NM_023914) Human Tagged ORF Clone
RC217904L3

USD 620.00

3 Weeks

Lenti ORF clone of Human purinergic receptor P2Y, G-protein coupled, 13 (P2RY13), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GPR86 (P2RY13) (NM_023914) Human Tagged ORF Clone Lentiviral Particle
RC217904L3V

USD 820.00

5 Weeks

Lenti ORF particles, P2RY13 (Myc-DDK tagged) - Human purinergic receptor P2Y, G-protein coupled, 13 (P2RY13), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GPR86 (P2RY13) (NM_023914) Human Tagged ORF Clone
RC217904L4

USD 620.00

3 Weeks

Lenti ORF clone of Human purinergic receptor P2Y, G-protein coupled, 13 (P2RY13), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GPR86 (P2RY13) (NM_023914) Human Tagged ORF Clone Lentiviral Particle
RC217904L4V

USD 820.00

7 Weeks

Lenti ORF particles, P2RY13 (mGFP-tagged) - Human purinergic receptor P2Y, G-protein coupled, 13 (P2RY13), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GPR86 (P2RY13) (NM_023914) Human Untagged Clone
SC112338

USD 680.00

In Stock

P2RY13 (untagged)-Human purinergic receptor P2Y, G-protein coupled, 13 (P2RY13), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
GPR86 (P2RY13) (NM_176894) Human Untagged Clone
SC321854

USD 600.00

In Stock

P2RY13 (untagged)-Human purinergic receptor P2Y, G-protein coupled, 13 (P2RY13)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
GPR86 (P2RY13) (NM_176894) Human Tagged ORF Clone
RC207883L1

USD 768.00

In Stock

Lenti ORF clone of Human purinergic receptor P2Y, G-protein coupled, 13 (P2RY13), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
GPR86 (P2RY13) (NM_023914) Human Tagged ORF Clone
RC217904L1

USD 768.00

In Stock

Lenti ORF clone of Human purinergic receptor P2Y, G-protein coupled, 13 (P2RY13), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
GPR86 (P2RY13) (NM_176894) Human Over-expression Lysate
LY406146

USD 396.00

5 Days

Transient overexpression lysate of purinergic receptor P2Y, G-protein coupled, 13 (P2RY13)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GPR86 (P2RY13) Rabbit Polyclonal Antibody
TA328651

USD 585.00

3 Weeks

Rabbit Polyclonal Anti-P2Y13 Receptor

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide DRFLKIIRPLRNIFLK(C), corresponding to amino acid residues 119-134 of human P2Y13. 2nd Intracellular loop.
GPR86 (P2RY13) (NM_176894) Human Tagged ORF Clone
RC207883L2

USD 620.00

3 Weeks

Lenti ORF clone of Human purinergic receptor P2Y, G-protein coupled, 13 (P2RY13), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
GPR86 (P2RY13) (NM_023914) Human Tagged ORF Clone
RC217904L2

USD 620.00

3 Weeks

Lenti ORF clone of Human purinergic receptor P2Y, G-protein coupled, 13 (P2RY13), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
GPR86 (P2RY13) Rabbit Polyclonal Antibody
TA312556

USD 345.00

In Stock

Rabbit polyclonal anti-P2RY13 antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human P2RY13.
GPR86 (P2RY13) (NM_176894) Human Over-expression Lysate
LC406146

USD 121.00

In Stock

P2RY13 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GPR86 (P2RY13) Rabbit Polyclonal Antibody
TA337752

USD 375.00

5 Days

Rabbit Polyclonal Anti-P2RY13 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-P2RY13 antibody is: synthetic peptide directed towards the C-terminal region of Human P2RY13. Synthetic peptide located within the following region: YTHSQTNNKTDCRLQNQLFIAKETTLFLAATNICMDPLIYIFLCKKFTEK
GPR86 (P2RY13) Rabbit Polyclonal Antibody
TA317552

USD 425.00

5 Days

P2Y13 / P2RY13 Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human
Conjugation Unconjugated
Immunogen P2Y13 / P2RY13 antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human P2RY13 / P2Y13. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Marmoset, Bovine, Bat (94%); Dog, Pig (81%).
GPR86 (P2RY13) Rabbit Polyclonal Antibody
TA317656

USD 425.00

5 Days

P2Y13 / P2RY13 Rabbit Polyclonal (Extracellular Domain) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human
Immunogen P2Y13 / P2RY13 antibody was raised against synthetic 17 amino acid peptide from 3rd extracellular domain of human P2RY13 / P2Y13. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Panda (100%); Marmoset, Elephant, Bovine, Rabbit (94%); Mouse, Bat, Horse (88%); Rat, Hamster, Dog, Chicken, Platypus (82%).
GPR86 (P2RY13) (NM_023914) Human Over-expression Lysate
LC402959

USD 121.00

2 Weeks

P2RY13 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GPR86 (P2RY13) (NM_023914) Human Over-expression Lysate
LC429721

USD 121.00

2 Weeks

P2RY13 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GPR86 (P2RY13) (NM_023914) Human Over-expression Lysate
LY402959

USD 396.00

5 Days

Transient overexpression lysate of purinergic receptor P2Y, G-protein coupled, 13 (P2RY13), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LY402959 is the same product as LY429721.
GPR86 (P2RY13) (NM_023914) Human Over-expression Lysate
LY429721

USD 396.00

5 Days

Transient overexpression lysate of purinergic receptor P2Y, G-protein coupled, 13 (P2RY13), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GPR86 (P2RY13) (NM_176894) Human Untagged Clone
SC327805

USD 600.00

3 Weeks

P2RY13 (untagged)-Human purinergic receptor P2Y G-protein coupled 13 (P2RY13)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
GPR86 (P2RY13) Rabbit Polyclonal Antibody
TA358809

USD 360.00

5 Days

P2RY13 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
GPR86 (P2RY13) (NM_176894) ICC Control Block
TB407883

USD 1,070.00

4 Weeks

Transient overexpression of P2RY13 (NM_176894) in HEK293T cells paraffin embedded controls for ICC/IHC staining

GPR86 (P2RY13) (NM_023914) ICC Control Block
TB417904

USD 1,070.00

4 Weeks

Transient overexpression of P2RY13 (NM_023914) in HEK293T cells paraffin embedded controls for ICC/IHC staining

GPR86 (P2RY13) Cytosection
TS407883

USD 225.00

4 Weeks

Transient overexpression of P2RY13 (NM_176894) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

GPR86 (P2RY13) Cytosection
TS407883P5

USD 889.00

4 Weeks

Transient overexpression of P2RY13 (NM_176894) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

GPR86 (P2RY13) Cytosection
TS417904

USD 225.00

4 Weeks

Transient overexpression of P2RY13 (NM_023914) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

GPR86 (P2RY13) ICC Control Sections
TS417904P5

USD 889.00

4 Weeks

Transient overexpression of P2RY13 (NM_023914) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack