Germany
Japan
United Kingdom
China
Lenti ORF particles, TAAR2 (Myc-DDK tagged) - Human trace amine associated receptor 2 (TAAR2), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Products
View as table DownloadLenti ORF particles, TAAR2 (mGFP-tagged) - Human trace amine associated receptor 2 (TAAR2), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
TAAR2 (Myc-DDK-tagged)-Human trace amine associated receptor 2 (TAAR2), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
TAAR2 (GFP-tagged) - Human trace amine associated receptor 2 (TAAR2), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
TAAR2 (Myc-DDK-tagged)-Human trace amine associated receptor 2 (TAAR2), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of TAAR2 (Myc-DDK-tagged)-Human trace amine associated receptor 2 (TAAR2), transcript variant 1
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, TAAR2 (Myc-DDK-tagged)-Human trace amine associated receptor 2 (TAAR2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of TAAR2 (mGFP-tagged)-Human trace amine associated receptor 2 (TAAR2), transcript variant 1
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, TAAR2 (mGFP-tagged)-Human trace amine associated receptor 2 (TAAR2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human trace amine associated receptor 2 (TAAR2), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, TAAR2 (Myc-DDK tagged) - Human trace amine associated receptor 2 (TAAR2), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human trace amine associated receptor 2 (TAAR2), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, TAAR2 (mGFP-tagged) - Human trace amine associated receptor 2 (TAAR2), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
TAAR2 (GFP-tagged) - Human trace amine associated receptor 2 (TAAR2), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human trace amine associated receptor 2 (TAAR2), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human trace amine associated receptor 2 (TAAR2), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
TAAR2 (untagged)-Human trace amine associated receptor 2 (TAAR2), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
TAAR2 (untagged)-Human trace amine associated receptor 2 (TAAR2), transcript variant 2
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
GPR58 / TAAR2 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | TAAR2 / GPR58 antibody was raised against synthetic 18 amino acid peptide from C-terminus of human TAAR2. Percent identity with other species by BLAST analysis: Human (100%); Marmoset (83%). |
Rabbit polyclonal TAAR2 Antibody (N-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This TAAR2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human TAAR2. |
Rabbit Polyclonal Anti-TAAR2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TAAR2 antibody is: synthetic peptide directed towards the C-terminal region of Human TAAR2. Synthetic peptide located within the following region: ENQNNQVKKDKKAAKTLGIVIGVFLLCWFPCFFTILLDPFLNFSTPVVLF |
Transient overexpression of TAAR2 (NM_001033080) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of TAAR2 (NM_014626) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of TAAR2 (NM_001033080) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of TAAR2 (NM_001033080) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of TAAR2 (NM_014626) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of TAAR2 (NM_014626) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- TAAR2
Families
- GPCR