ACCN1 (ASIC2) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 127~156 amino acids from the Center region of human ACCN1 |
ACCN1 (ASIC2) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 127~156 amino acids from the Center region of human ACCN1 |
Rabbit Polyclonal Anti-ACCN1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACCN1 antibody: synthetic peptide directed towards the middle region of human ACCN1. Synthetic peptide located within the following region: LLDLLGKEEDEGSHDENVSTCDTMPNHSETISHTVNVPLQTTLGTLEEIA |
Rabbit polyclonal Anti-ASIC2a
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | Peptide DLKESPSEGSLQPSSIQC, corresponding to amino acid residues 2-18 of human ASIC2a. Intracellular, N-terminus. |
Rabbit Polyclonal Anti-ACCN1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACCN1 antibody: synthetic peptide directed towards the C terminal of human ACCN1. Synthetic peptide located within the following region: GDIGGQMGLFIGASILTILELFDYIYELIKEKLLDLLGKEEDEGSHDENV |