Products

cDNA Clones (7)
Antibodies (3)
Proteins (3)
Jump to Filters
View as table Download
BEST4 (NM_153274) Human Tagged ORF Clone
RC211033

USD 420.00

In Stock

BEST4 (Myc-DDK-tagged)-Human bestrophin 4 (BEST4)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
BEST4 (NM_153274) Human Tagged ORF Clone
RC211033L3

USD 620.00

3 Weeks

Lenti ORF clone of Human bestrophin 4 (BEST4), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
BEST4 (NM_153274) Human Tagged ORF Clone
RC211033L4

USD 620.00

3 Weeks

Lenti ORF clone of Human bestrophin 4 (BEST4), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
BEST4 (NM_153274) Human Tagged ORF Clone
RG211033

USD 460.00

3 Weeks

BEST4 (GFP-tagged) - Human bestrophin 4 (BEST4)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
BEST4 (NM_153274) Human Untagged Clone
SC310350

USD 760.00

In Stock

BEST4 (untagged)-Human bestrophin 4 (BEST4)

Vector PCMV6-Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
SC310350 is the updated version of SC122213.
BEST4 Rabbit Polyclonal Antibody
TA316567

USD 425.00

5 Days

BEST4 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human, Monkey
Conjugation Unconjugated
Immunogen BEST4 antibody was raised against synthetic 15 amino acid peptide from internal region of human BEST4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Rabbit (93%); Hamster (87%); Pig (80%).
BEST4 Rabbit Polyclonal Antibody
TA338739

USD 310.00

5 Days

Rabbit Polyclonal Anti-VMD2L2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VMD2L2 antibody: synthetic peptide directed towards the N terminal of human VMD2L2. Synthetic peptide located within the following region: MTVSYTLKVAEARFGGFSGLLLRWRGSIYKLLYKEFLLFGALYAVLSITY
BEST4 Rabbit Polyclonal Antibody
TA316566

USD 425.00

5 Days

BEST4 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Gibbon, Bovine, Gorilla, Human, Pig, Rabbit
Conjugation Unconjugated
Immunogen BEST4 antibody was raised against synthetic 18 amino acid peptide from internal region of human BEST4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Bovine, Bat, Rabbit, Pig (100%); Marmoset, Rat, Horse (94%); Dog (89%); Panda, Lizard (83%).
BEST4 (NM_153274) ICC Control Block
TB411033

USD 1,070.00

4 Weeks

Transient overexpression of BEST4 (NM_153274) in HEK293T cells paraffin embedded controls for ICC/IHC staining

BEST4 Cytosection
TS411033

USD 225.00

4 Weeks

Transient overexpression of BEST4 (NM_153274) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

BEST4 Cytosection
TS411033P5

USD 889.00

4 Weeks

Transient overexpression of BEST4 (NM_153274) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack