Germany
Japan
United Kingdom
China
NOX1 (Myc-DDK-tagged)-Human NADPH oxidase 1 (NOX1), transcript variant NOH-1L
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table Download
Lenti ORF particles, NOX1 (Myc-DDK tagged) - Human NADPH oxidase 1 (NOX1), transcript variant NOH-1L, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, NOX1 (mGFP-tagged) - Human NADPH oxidase 1 (NOX1), transcript variant NOH-1L, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
NOX1 (GFP-tagged) - Human NADPH oxidase 1 (NOX1), transcript variant NOH-1L
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
NOX1 (Myc-DDK-tagged)-Human NADPH oxidase 1 (NOX1), transcript variant NOH-1Lv
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
NOX1 (Myc-DDK tagged) - Homo sapiens NADPH oxidase 1 (NOX1), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
NOX1 (GFP-tagged) - Human NADPH oxidase 1 (NOX1), transcript variant NOH-1Lv
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human NADPH oxidase 1 (NOX1), transcript variant NOH-1L, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, NOX1 (Myc-DDK tagged) - Human NADPH oxidase 1 (NOX1), transcript variant NOH-1L, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, NOX1 (mGFP-tagged) - Human NADPH oxidase 1 (NOX1), transcript variant NOH-1L, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of NOX1 (Myc-DDK-tagged)-Human NADPH oxidase 1 (NOX1), transcript variant NOH-1Lv
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, NOX1 (Myc-DDK-tagged)-Human NADPH oxidase 1 (NOX1), transcript variant NOH-1Lv, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of NOX1 (mGFP-tagged)-Human NADPH oxidase 1 (NOX1), transcript variant NOH-1Lv
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, NOX1 (mGFP-tagged)-Human NADPH oxidase 1 (NOX1), transcript variant NOH-1Lv, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
NOX1 (GFP-tagged) - Homo sapiens NADPH oxidase 1 (NOX1), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
NOX1 (untagged)-Human NADPH oxidase 1 (NOX1), transcript variant NOH-1L
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human NADPH oxidase 1 (NOX1), transcript variant NOH-1L, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human NADPH oxidase 1 (NOX1), transcript variant NOH-1L, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Goat Anti-NOX1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DKATDIVTGLKQK, from the internal region of the protein sequence according to NP_008983.2; NP_39249.1. |
Rabbit polyclonal anti-NOX1 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human NOX1. |
NOX1 (untagged)-Human NADPH oxidase 1 (NOX1), transcript variant NOH-1Lv
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human NADPH oxidase 1 (NOX1), transcript variant NOH-1L, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Anti-NOX1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NOX1 antibody: synthetic peptide directed towards the C terminal of human NOX1. Synthetic peptide located within the following region: STIATSHPKSVVGVFLCGPRTLAKSLRKCCHRYSSLDPRKVQFYFNKENF |
NOX1 (untagged) - Homo sapiens NADPH oxidase 1 (NOX1), transcript variant 3
| Vector | pCMV6 series |
| Tag | Tag Free |
Transient overexpression of NOX1 (NM_013955) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of NOX1 (NM_007052) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of NOX1 (NM_013955) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of NOX1 (NM_013955) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of NOX1 (NM_001271815) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Active filters
Target Symbol
- NOX1
Families
- Ion Channels: Other