NOX1 Rabbit Polyclonal Antibody

CAT#: TA341879

Rabbit Polyclonal Anti-NOX1 Antibody

Product Images

WB Suggested Anti-NOX1 Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysate

• 

  NOX1 antibody - C-terminal region validated by WB using Epithelial Colorectal Adenocarcinoma CaCO2 at 1: 10.

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NOX1 antibody: synthetic peptide directed towards the C terminal of human NOX1. Synthetic peptide located within the following region: STIATSHPKSVVGVFLCGPRTLAKSLRKCCHRYSSLDPRKVQFYFNKENF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 65 kDa
• Gene Name: NADPH oxidase 1
• Database Link:
  NP_008983
  Entrez Gene 27035 Human
  UniProt ID Q9Y5S8
• Background: This gene encodes a member ofThe NADPH oxidase family of enzymes responsible forThe catalytic one-electron transfer of oxygen to generate superoxide or hydrogen peroxide. Alternatively spliced transcript variants encoding multiple isoforms have been observed forThis gene. [provided by RefSeq, Nov 2012]
• Synonyms: GP91-2; MOX1; NOH-1; NOH1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%; Zebrafish: 79%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Other, Transmembrane
• Protein Pathways: Leukocyte transendothelial migration