KCNC4 (Myc-DDK-tagged)-Human potassium voltage-gated channel, Shaw-related subfamily, member 4 (KCNC4), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
KCNC4 (Myc-DDK-tagged)-Human potassium voltage-gated channel, Shaw-related subfamily, member 4 (KCNC4), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
KCNC4 (GFP-tagged) - Human potassium voltage-gated channel, Shaw-related subfamily, member 4 (KCNC4), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, KCNC4 (Myc-DDK tagged) - Human potassium voltage-gated channel, Shaw-related subfamily, member 4 (KCNC4), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, KCNC4 (mGFP-tagged) - Human potassium voltage-gated channel, Shaw-related subfamily, member 4 (KCNC4), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
KCNC4 (Myc-DDK-tagged)-Human potassium voltage-gated channel, Shaw-related subfamily, member 4 (KCNC4), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
KCNC4 (Myc-DDK-tagged)-Human potassium voltage-gated channel, Shaw-related subfamily, member 4 (KCNC4), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
KCNC4 (GFP-tagged) - Human potassium voltage-gated channel, Shaw-related subfamily, member 4 (KCNC4), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human potassium voltage-gated channel, Shaw-related subfamily, member 4 (KCNC4), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, KCNC4 (Myc-DDK tagged) - Human potassium voltage-gated channel, Shaw-related subfamily, member 4 (KCNC4), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human potassium voltage-gated channel, Shaw-related subfamily, member 4 (KCNC4), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, KCNC4 (mGFP-tagged) - Human potassium voltage-gated channel, Shaw-related subfamily, member 4 (KCNC4), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human potassium voltage-gated channel, Shaw-related subfamily, member 4 (KCNC4), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, KCNC4 (Myc-DDK tagged) - Human potassium voltage-gated channel, Shaw-related subfamily, member 4 (KCNC4), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human potassium voltage-gated channel, Shaw-related subfamily, member 4 (KCNC4), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, KCNC4 (mGFP-tagged) - Human potassium voltage-gated channel, Shaw-related subfamily, member 4 (KCNC4), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of KCNC4 (Myc-DDK-tagged)-Human potassium voltage-gated channel, Shaw-related subfamily, member 4 (KCNC4), transcript variant 3
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, KCNC4 (Myc-DDK-tagged)-Human potassium voltage-gated channel, Shaw-related subfamily, member 4 (KCNC4), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of KCNC4 (mGFP-tagged)-Human potassium voltage-gated channel, Shaw-related subfamily, member 4 (KCNC4), transcript variant 3
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, KCNC4 (mGFP-tagged)-Human potassium voltage-gated channel, Shaw-related subfamily, member 4 (KCNC4), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
KCNC4 (GFP-tagged) - Human potassium voltage-gated channel, Shaw-related subfamily, member 4 (KCNC4), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
KCNC4 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Lenti ORF clone of Human potassium voltage-gated channel, Shaw-related subfamily, member 4 (KCNC4), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human potassium voltage-gated channel, Shaw-related subfamily, member 4 (KCNC4), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
KCNC4 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
KCNC4 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of potassium voltage-gated channel, Shaw-related subfamily, member 4 (KCNC4), transcript variant 3
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
KCNC4 (untagged)-Human potassium voltage-gated channel, Shaw-related subfamily, member 4 (KCNC4), transcript variant 1
Vector | pCMV6-XL6 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-KCNC4 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KCNC4 antibody: synthetic peptide directed towards the middle region of human KCNC4. Synthetic peptide located within the following region: NIDRNVTEILRVGNITSVHFRREVETEPILTYIEGVCVLWFTLEFLVRIV |
KCNC4 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 517-546 amino acids from the C-terminal region of human KCNC4 |
Transient overexpression lysate of potassium voltage-gated channel, Shaw-related subfamily, member 4 (KCNC4), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
KCNC4 (untagged)-Human potassium voltage-gated channel, Shaw-related subfamily, member 4 (KCNC4), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
KCNC4 (untagged)-Human potassium voltage-gated channel, Shaw-related subfamily, member 4 (KCNC4), transcript variant 3
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression of KCNC4 (NM_153763) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of KCNC4 (NM_004978) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of KCNC4 (NM_001039574) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of KCNC4 (NM_153763) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of KCNC4 (NM_153763) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of KCNC4 (NM_004978) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of KCNC4 (NM_004978) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of KCNC4 (NM_001039574) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of KCNC4 (NM_001039574) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack