Germany
Japan
United Kingdom
China
KCND2 (Myc-DDK-tagged)-Human potassium voltage-gated channel, Shal-related subfamily, member 2 (KCND2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
KCND2 (GFP-tagged) - Human potassium voltage-gated channel, Shal-related subfamily, member 2 (KCND2)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, KCND2 (Myc-DDK tagged) - Human potassium voltage-gated channel, Shal-related subfamily, member 2 (KCND2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, KCND2 (mGFP-tagged) - Human potassium voltage-gated channel, Shal-related subfamily, member 2 (KCND2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
KCND2 (untagged)-Human potassium voltage-gated channel, Shal-related subfamily, member 2 (KCND2)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human potassium voltage-gated channel, Shal-related subfamily, member 2 (KCND2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, KCND2 (Myc-DDK tagged) - Human potassium voltage-gated channel, Shal-related subfamily, member 2 (KCND2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human potassium voltage-gated channel, Shal-related subfamily, member 2 (KCND2), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, KCND2 (mGFP-tagged) - Human potassium voltage-gated channel, Shal-related subfamily, member 2 (KCND2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human potassium voltage-gated channel, Shal-related subfamily, member 2 (KCND2), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
KCND2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-KCND2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCND2 antibody: synthetic peptide directed towards the middle region of human KCND2. Synthetic peptide located within the following region: RIRAAKSGSANAYMQSKRNGLLSNQLQSSEDEQAFVSKSGSSFETQHHHL |
Transient overexpression lysate of potassium voltage-gated channel, Shal-related subfamily, member 2 (KCND2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Transient overexpression of KCND2 (NM_012281) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of KCND2 (NM_012281) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of KCND2 (NM_012281) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- KCND2
Families
- Ion Channels: Potassium