Germany
Japan
United Kingdom
China
HNF4G (Myc-DDK-tagged)-Human hepatocyte nuclear factor 4, gamma (HNF4G)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti-ORF clone of HNF4G (Myc-DDK-tagged)-Human hepatocyte nuclear factor 4, gamma (HNF4G)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, HNF4G (Myc-DDK-tagged)-Human hepatocyte nuclear factor 4, gamma (HNF4G), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of HNF4G (mGFP-tagged)-Human hepatocyte nuclear factor 4, gamma (HNF4G)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, HNF4G (mGFP-tagged)-Human hepatocyte nuclear factor 4, gamma (HNF4G), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
HNF4G (GFP-tagged) - Human hepatocyte nuclear factor 4, gamma (HNF4G)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
HNF4G (untagged)-Human hepatocyte nuclear factor 4, gamma (HNF4G)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
HNF4G (untagged)-Human hepatocyte nuclear factor 4, gamma (HNF4G)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Transient overexpression lysate of hepatocyte nuclear factor 4, gamma (HNF4G)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-HNF4G Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNF4G antibody: synthetic peptide directed towards the C terminal of human HNF4G. Synthetic peptide located within the following region: MSTLVHADQISTPETPLPSPPQGSGQEQYKIAANQASVISHQHLSKQKQL |
HNF4G / HNF4 Gamma Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | HNF4G / HNF4 Gamma antibody was raised against synthetic 16 amino acid peptide from internal region of human HNF4G. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Marmoset, Mouse, Elephant, Panda, Dog (94%); Bat, Horse, Turkey, Chicken (88%); Rat, Pig, Opossum, Platypus (81%). |
Rabbit Polyclonal Anti-HNF4G Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNF4G antibody: synthetic peptide directed towards the N terminal of human HNF4G. Synthetic peptide located within the following region: MDMANYSEVLDPTYTTLEFETMQILYNSSDSSAPETSMNTTDNGVNCLCA |
Rabbit Polyclonal Anti-HNF4G Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNF4G antibody: synthetic peptide directed towards the C terminal of human HNF4G. Synthetic peptide located within the following region: QDPLTGQTILLGPMSTLVHADQISTPETPLPSPPQGSGQEQYKIAANQAS |
Rabbit Polyclonal Anti-Hnf4g Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Hnf4g antibody is: synthetic peptide directed towards the C-terminal region of Mouse Hnf4g. Synthetic peptide located within the following region: DPLTGQTILLGPMSTLVHTDQIATPETPLPSPPQGSGQEPYKITANQASV |
HNF4G HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression of HNF4G (NM_004133) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of HNF4G (NM_004133) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of HNF4G (NM_004133) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- HNF4G
Families
- Nuclear Hormone Receptor