Products

cDNA Clones (36)
Proteins (14)
Antibodies (7)
Jump to Filters
View as table Download
NR2F2 (NM_021005) Human Untagged Clone
SC108069

USD 310.00

In Stock

NR2F2 (untagged)-Human nuclear receptor subfamily 2, group F, member 2 (NR2F2), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
NR2F2 (NM_021005) Human Tagged ORF Clone
RC206753

USD 420.00

In Stock

NR2F2 (Myc-DDK-tagged)-Human nuclear receptor subfamily 2, group F, member 2 (NR2F2), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
NR2F2 (NM_001145155) Human Tagged ORF Clone
RC226609

USD 420.00

In Stock

NR2F2 (Myc-DDK-tagged)-Human nuclear receptor subfamily 2, group F, member 2 (NR2F2), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
NR2F2 (NM_021005) Human Tagged ORF Clone Lentiviral Particle
RC206753L2V

USD 820.00

3 Weeks

Lenti ORF particles, NR2F2 (mGFP-tagged)-Human nuclear receptor subfamily 2, group F, member 2 (NR2F2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
NR2F2 (NM_021005) Human Tagged ORF Clone Lentiviral Particle
RC206753L1V

USD 820.00

3 Weeks

Lenti ORF particles, NR2F2 (Myc-DDK-tagged)-Human nuclear receptor subfamily 2, group F, member 2 (NR2F2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
NR2F2 (NM_001145155) Human Tagged ORF Clone Lentiviral Particle
RC226609L1V

USD 820.00

6 Weeks

Lenti ORF particles, NR2F2 (Myc-DDK tagged) - Human nuclear receptor subfamily 2, group F, member 2 (NR2F2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
NR2F2 (NM_001145155) Human Tagged ORF Clone Lentiviral Particle
RC226609L2V

USD 820.00

3 Weeks

Lenti ORF particles, NR2F2 (mGFP-tagged) - Human nuclear receptor subfamily 2, group F, member 2 (NR2F2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
NR2F2 (NM_021005) Human Tagged ORF Clone
RG206753

USD 460.00

In Stock

NR2F2 (GFP-tagged) - Human nuclear receptor subfamily 2, group F, member 2 (NR2F2), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
NR2F2 (NM_001145155) Human Tagged ORF Clone
RG226609

USD 460.00

In Stock

NR2F2 (GFP-tagged) - Human nuclear receptor subfamily 2, group F, member 2 (NR2F2), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
NR2F2 (NM_021005) Human Tagged ORF Clone
RC206753L3

USD 620.00

3 Weeks

Lenti-ORF clone of NR2F2 (Myc-DDK-tagged)-Human nuclear receptor subfamily 2, group F, member 2 (NR2F2), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NR2F2 (NM_021005) Human Tagged ORF Clone Lentiviral Particle
RC206753L3V

USD 820.00

7 Weeks

Lenti ORF particles, NR2F2 (Myc-DDK-tagged)-Human nuclear receptor subfamily 2, group F, member 2 (NR2F2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NR2F2 (NM_021005) Human Tagged ORF Clone
RC206753L4

USD 620.00

3 Weeks

Lenti-ORF clone of NR2F2 (mGFP-tagged)-Human nuclear receptor subfamily 2, group F, member 2 (NR2F2), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NR2F2 (NM_021005) Human Tagged ORF Clone Lentiviral Particle
RC206753L4V

USD 820.00

7 Weeks

Lenti ORF particles, NR2F2 (mGFP-tagged)-Human nuclear receptor subfamily 2, group F, member 2 (NR2F2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NR2F2 (NM_001145155) Human Tagged ORF Clone
RC226609L3

USD 620.00

3 Weeks

Lenti ORF clone of Human nuclear receptor subfamily 2, group F, member 2 (NR2F2), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NR2F2 (NM_001145155) Human Tagged ORF Clone Lentiviral Particle
RC226609L3V

USD 820.00

7 Weeks

Lenti ORF particles, NR2F2 (Myc-DDK tagged) - Human nuclear receptor subfamily 2, group F, member 2 (NR2F2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NR2F2 (NM_001145155) Human Tagged ORF Clone
RC226609L4

USD 620.00

3 Weeks

Lenti ORF clone of Human nuclear receptor subfamily 2, group F, member 2 (NR2F2), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NR2F2 (NM_001145155) Human Tagged ORF Clone Lentiviral Particle
RC226609L4V

USD 820.00

5 Weeks

Lenti ORF particles, NR2F2 (mGFP-tagged) - Human nuclear receptor subfamily 2, group F, member 2 (NR2F2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NR2F2 (NM_001145156) Human Tagged ORF Clone
RC226714

USD 440.00

3 Weeks

NR2F2 (Myc-DDK-tagged)-Human nuclear receptor subfamily 2, group F, member 2 (NR2F2), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
NR2F2 (NM_001145156) Human Tagged ORF Clone
RC226714L3

USD 640.00

3 Weeks

Lenti-ORF clone of NR2F2 (Myc-DDK-tagged)-Human nuclear receptor subfamily 2, group F, member 2 (NR2F2), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NR2F2 (NM_001145156) Human Tagged ORF Clone Lentiviral Particle
RC226714L3V

USD 840.00

6 Weeks

Lenti ORF particles, NR2F2 (Myc-DDK-tagged)-Human nuclear receptor subfamily 2, group F, member 2 (NR2F2), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NR2F2 (NM_001145156) Human Tagged ORF Clone Lentiviral Particle
RC226714L4V

USD 840.00

In Stock

Lenti ORF particles, NR2F2 (mGFP-tagged)-Human nuclear receptor subfamily 2, group F, member 2 (NR2F2), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NR2F2 (NM_001145157) Human Tagged ORF Clone
RC226862

USD 440.00

3 Weeks

NR2F2 (Myc-DDK-tagged)-Human nuclear receptor subfamily 2, group F, member 2 (NR2F2), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
NR2F2 (NM_001145157) Human Tagged ORF Clone
RC226862L3

USD 640.00

3 Weeks

Lenti-ORF clone of NR2F2 (Myc-DDK-tagged)-Human nuclear receptor subfamily 2, group F, member 2 (NR2F2), transcript variant 4

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NR2F2 (NM_001145157) Human Tagged ORF Clone Lentiviral Particle
RC226862L3V

USD 840.00

6 Weeks

Lenti ORF particles, NR2F2 (Myc-DDK-tagged)-Human nuclear receptor subfamily 2, group F, member 2 (NR2F2), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NR2F2 (NM_001145157) Human Tagged ORF Clone
RC226862L4

USD 640.00

3 Weeks

Lenti-ORF clone of NR2F2 (mGFP-tagged)-Human nuclear receptor subfamily 2, group F, member 2 (NR2F2), transcript variant 4

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NR2F2 (NM_001145157) Human Tagged ORF Clone Lentiviral Particle
RC226862L4V

USD 840.00

6 Weeks

Lenti ORF particles, NR2F2 (mGFP-tagged)-Human nuclear receptor subfamily 2, group F, member 2 (NR2F2), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NR2F2 (NM_001145156) Human Tagged ORF Clone
RG226714

USD 480.00

3 Weeks

NR2F2 (GFP-tagged) - Human nuclear receptor subfamily 2, group F, member 2 (NR2F2), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
NR2F2 (NM_001145157) Human Tagged ORF Clone
RG226862

USD 480.00

4 Weeks

NR2F2 (GFP-tagged) - Human nuclear receptor subfamily 2, group F, member 2 (NR2F2), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
NR2F2 (NM_021005) Human Tagged Lenti ORF Clone
RC206753L2

USD 768.00

In Stock

Lenti-ORF clone of NR2F2 (mGFP-tagged)-Human nuclear receptor subfamily 2, group F, member 2 (NR2F2), transcript variant 1

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
NR2F2 (NM_001145155) Human Tagged Lenti ORF Clone
RC226609L2

USD 768.00

In Stock

Lenti ORF clone of Human nuclear receptor subfamily 2, group F, member 2 (NR2F2), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
NR2F2 (NM_021005) Human Tagged Lenti ORF Clone
RC206753L1

USD 768.00

In Stock

Lenti-ORF clone of NR2F2 (Myc-DDK-tagged)-Human nuclear receptor subfamily 2, group F, member 2 (NR2F2), transcript variant 1

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
NR2F2 Rabbit Polyclonal Antibody
TA345312

USD 410.00

5 Days

Rabbit Polyclonal Anti-NR2F2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR2F2 antibody: synthetic peptide directed towards the N terminal of human NR2F2. Synthetic peptide located within the following region: QDEVPGSQGSQASQAPPVPGPPPGAPHTPQTPGQGGPASTPAQTAAGGQG
NR2F2 (NM_001145156) Human Untagged Clone
SC324861

USD 420.00

4 Weeks

NR2F2 (untagged)-Human nuclear receptor subfamily 2, group F, member 2 (NR2F2), transcript variant 3

Vector pCMV6 series
Tag Tag Free
NR2F2 Rabbit Polyclonal Antibody
TA314613

USD 345.00

In Stock

Rabbit polyclonal anti-COT2 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human COT2.
NR2F2 Rabbit Polyclonal Antibody
TA345313

USD 410.00

5 Days

Rabbit Polyclonal Anti-NR2F2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR2F2 antibody: synthetic peptide directed towards the C terminal of human NR2F2. Synthetic peptide located within the following region: EYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRF
NR2F2 (NM_021005) Human Over-expression Lysate
LY412132

USD 396.00

In Stock

Transient overexpression lysate of nuclear receptor subfamily 2, group F, member 2 (NR2F2), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
NR2F2 (NM_001145155) Human Over-expression Lysate
LY428730

USD 396.00

In Stock

Transient overexpression lysate of nuclear receptor subfamily 2, group F, member 2 (NR2F2), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
NR2F2 (NM_001145155) Human Tagged ORF Clone
RC226609L1

USD 620.00

3 Weeks

Lenti ORF clone of Human nuclear receptor subfamily 2, group F, member 2 (NR2F2), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
NR2F2 Rabbit Polyclonal Antibody
TA324540

USD 450.00

3 Weeks

Rabbit polyclonal NR2F2 Antibody (N-term)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This NR2F2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human NR2F2.
NR2F2 (NM_021005) Human Over-expression Lysate
LC412132

USD 121.00

In Stock

NR2F2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
NR2F2 (NM_001145155) Human Over-expression Lysate
LC428730

USD 121.00

In Stock

NR2F2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
NR2F2 Rabbit Polyclonal Antibody
TA330083

USD 375.00

5 Days

Rabbit Polyclonal Anti-NR2F2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR2F2 antibody: synthetic peptide directed towards the N terminal of human NR2F2. Synthetic peptide located within the following region: KVGMRREAVQRGRMPPTQPTHGQFALTNGDPLNCHSYLSGYISLLLRAEP
NR2F2 Rabbit Polyclonal Antibody
TA330082

USD 375.00

5 Days

Rabbit Polyclonal Anti-NR2F2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR2F2 antibody: synthetic peptide directed towards the N terminal of human NR2F2. Synthetic peptide located within the following region: AMVVSTWRDPQDEVPGSQGSQASQAPPVPGPPPGAPHTPQTPGQGGPAST
NR2F2 (NM_001145156) Human Tagged ORF Clone
RC226714L4

USD 640.00

In Stock

Lenti-ORF clone of NR2F2 (mGFP-tagged)-Human nuclear receptor subfamily 2, group F, member 2 (NR2F2), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NR2F2 (NM_001145157) Human Untagged Clone
SC324862

USD 420.00

4 Weeks

NR2F2 (untagged)-Human nuclear receptor subfamily 2, group F, member 2 (NR2F2), transcript variant 4

Vector pCMV6 series
Tag Tag Free
NR2F2 (NM_001145155) Human Untagged Clone
SC325706

USD 660.00

3 Weeks

NR2F2 (untagged)-Human nuclear receptor subfamily 2, group F, member 2 (NR2F2), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
NR2F2 Rabbit Polyclonal Antibody
TA351462

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-NR2F2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human NR2F2
NR2F2 ICC Control Block
TB406753

USD 1,070.00

4 Weeks

Transient overexpression of NR2F2 (NM_021005) in HEK293T cells paraffin embedded controls for ICC/IHC staining

NR2F2 ICC Control Block
TB426609

USD 1,070.00

4 Weeks

Transient overexpression of NR2F2 (NM_001145155) in HEK293T cells paraffin embedded controls for ICC/IHC staining

NR2F2 ICC Control Block
TB426714

USD 1,090.00

4 Weeks

Transient overexpression of NR2F2 (NM_001145156) in HEK293T cells paraffin embedded controls for ICC/IHC staining