Rabbit Polyclonal EPM2A Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | EPM2A antibody was raised against a 17 amino acid synthetic peptide near the carboxy terminus of human EPM2A. |
Rabbit Polyclonal EPM2A Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | EPM2A antibody was raised against a 17 amino acid synthetic peptide near the carboxy terminus of human EPM2A. |
Goat Anti-Laforin (isoform a) Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-EATGHTNEMKHTTD, from the internal region of the protein sequence according to NP_005661.1. |
Rabbit Polyclonal Anti-EPM2A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EPM2A antibody is: synthetic peptide directed towards the N-terminal region of Human EPM2A. Synthetic peptide located within the following region: PGRVDTFWYKFLKREPGGELSWEGNGPHHDRCCTYNENNLVDGVYCLPIG |