Lenti ORF particles, MTMR1 (mGFP-tagged) - Human myotubularin related protein 1 (MTMR1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, MTMR1 (mGFP-tagged) - Human myotubularin related protein 1 (MTMR1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
MTMR1 (Myc-DDK-tagged)-Human myotubularin related protein 1 (MTMR1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, MTMR1 (Myc-DDK tagged) - Human myotubularin related protein 1 (MTMR1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, MTMR1 (mGFP-tagged) - Human myotubularin related protein 1 (MTMR1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF clone of Human myotubularin related protein 1 (MTMR1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, MTMR1 (Myc-DDK tagged) - Human myotubularin related protein 1 (MTMR1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human myotubularin related protein 1 (MTMR1), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
MTMR1 (GFP-tagged) - Human myotubularin related protein 1 (MTMR1)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human myotubularin related protein 1 (MTMR1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-MTMR1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MTMR1 antibody: synthetic peptide directed towards the C terminal of human MTMR1. Synthetic peptide located within the following region: KEDVYTKTISLWSYINSQLDEFSNPFFVNYENHVLYPVASLSHLELWVNY |
Lenti ORF clone of Human myotubularin related protein 1 (MTMR1), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
MTMR1 (untagged)-Human myotubularin related protein 1 (MTMR1)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Transient overexpression lysate of myotubularin related protein 1 (MTMR1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
MTMR1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
MTMR1 MS Standard C13 and N15-labeled recombinant protein (NP_003819)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Transient overexpression of MTMR1 (NM_003828) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MTMR1 (NM_003828) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of MTMR1 (NM_003828) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack