Products

View as table Download

Lenti ORF particles, MTMR1 (mGFP-tagged) - Human myotubularin related protein 1 (MTMR1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

MTMR1 (Myc-DDK-tagged)-Human myotubularin related protein 1 (MTMR1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, MTMR1 (Myc-DDK tagged) - Human myotubularin related protein 1 (MTMR1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, MTMR1 (mGFP-tagged) - Human myotubularin related protein 1 (MTMR1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

Lenti ORF clone of Human myotubularin related protein 1 (MTMR1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, MTMR1 (Myc-DDK tagged) - Human myotubularin related protein 1 (MTMR1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human myotubularin related protein 1 (MTMR1), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

MTMR1 (GFP-tagged) - Human myotubularin related protein 1 (MTMR1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human myotubularin related protein 1 (MTMR1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Rabbit Polyclonal Anti-MTMR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MTMR1 antibody: synthetic peptide directed towards the C terminal of human MTMR1. Synthetic peptide located within the following region: KEDVYTKTISLWSYINSQLDEFSNPFFVNYENHVLYPVASLSHLELWVNY

Lenti ORF clone of Human myotubularin related protein 1 (MTMR1), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

MTMR1 (untagged)-Human myotubularin related protein 1 (MTMR1)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

Transient overexpression lysate of myotubularin related protein 1 (MTMR1)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

MTMR1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

MTMR1 MS Standard C13 and N15-labeled recombinant protein (NP_003819)

Tag C-Myc/DDK
Expression Host HEK293

(untagged)-Human cDNA FLJ30951 fis, clone HCASM1000115

Vector pCMV6 series
Tag Tag Free

Transient overexpression of MTMR1 (NM_003828) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of MTMR1 (NM_003828) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of MTMR1 (NM_003828) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack