Germany
Japan
United Kingdom
China
DUSP22 (Myc-DDK-tagged)-Human dual specificity phosphatase 22 (DUSP22)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, DUSP22 (Myc-DDK tagged) - Human dual specificity phosphatase 22 (DUSP22), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, DUSP22 (mGFP-tagged) - Human dual specificity phosphatase 22 (DUSP22), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
DUSP22 (GFP-tagged) - Human dual specificity phosphatase 22 (DUSP22)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
DUSP22 (myc-DDK-tagged) - Human dual specificity phosphatase 22 (DUSP22), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human dual specificity phosphatase 22 (DUSP22), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, DUSP22 (Myc-DDK tagged) - Human dual specificity phosphatase 22 (DUSP22), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human dual specificity phosphatase 22 (DUSP22), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, DUSP22 (mGFP-tagged) - Human dual specificity phosphatase 22 (DUSP22), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human dual specificity phosphatase 22 (DUSP22), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Anti-DUSP22 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-DUSP22 antibody is: synthetic peptide directed towards the N-terminal region of Human DUSP22. Synthetic peptide located within the following region: LPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADS |
DUSP22 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of dual specificity phosphatase 22 (DUSP22)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human dual specificity phosphatase 22 (DUSP22), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Recombinant protein of human dual specificity phosphatase 22 (DUSP22), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
(untagged)-Human cDNA FLJ35864 fis, clone TESTI2007657, highly similar to Human mitogen-activated protein kinase phosphatase x (MKPX) mRNA
| Vector | pCMV6-XL6 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit polyclonal anti-DUSP22 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human DUSP22. |
Rabbit Polyclonal Anti-DUSP22 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DUSP22 / JSP 1 antibody was raised against synthetic 17 amino acid peptide from near N-terminus of human DUSP22. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Bovine, Horse, Rabbit (100%); Mouse, Rat (94%); Elephant, Chicken (88%); Xenopus (82%). |
MAP Kinase Phosphatase X (1-184, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
MAP Kinase Phosphatase X (1-184, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
DUSP22 (GFP-tagged) - Human dual specificity phosphatase 22 (DUSP22), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
DUSP22 (untagged)-Human dual specificity phosphatase 22 (DUSP22)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
SC310639 is the updated version of SC128057.
DUSP22 (untagged) - Human dual specificity phosphatase 22 (DUSP22), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression of DUSP22 (NM_020185) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of DUSP22 (NM_001286555) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of DUSP22 (NM_020185) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of DUSP22 (NM_020185) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of DUSP22 (NM_001286555) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of DUSP22 (NM_001286555) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- DUSP22
Families
- Phosphatase