Products

cDNA Clones (14)
Proteins (7)
Antibodies (6)
Jump to Filters
View as table Download
RPTP mu (PTPRM) (NM_001105244) Human Tagged ORF Clone
RC226398

USD 1,540.00

In Stock

PTPRM (Myc-DDK-tagged)-Human protein tyrosine phosphatase, receptor type, M (PTPRM), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
RPTP mu (PTPRM) (NM_001105244) Human Tagged ORF Clone
RG226398

USD 1,690.00

In Stock

PTPRM (GFP-tagged) - Human protein tyrosine phosphatase, receptor type, M (PTPRM), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
RPTP mu (PTPRM) (NM_002845) Human Tagged ORF Clone
RC219912

USD 1,520.00

2 Weeks

PTPRM (Myc-DDK-tagged)-Human protein tyrosine phosphatase, receptor type, M (PTPRM), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
RPTP mu (PTPRM) (NM_002845) Human Tagged ORF Clone
RG219912

USD 1,670.00

In Stock

PTPRM (GFP-tagged) - Human protein tyrosine phosphatase, receptor type, M (PTPRM), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
RPTP mu (PTPRM) (NM_002845) Human Tagged ORF Clone
RC219912L3

USD 1,720.00

3 Weeks

Lenti-ORF clone of PTPRM (Myc-DDK-tagged)-Human protein tyrosine phosphatase, receptor type, M (PTPRM), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RPTP mu (PTPRM) (NM_002845) Human Tagged ORF Clone Lentiviral Particle
RC219912L3V

USD 1,920.00

6 Weeks

Lenti ORF particles, PTPRM (Myc-DDK-tagged)-Human protein tyrosine phosphatase, receptor type, M (PTPRM), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RPTP mu (PTPRM) (NM_002845) Human Tagged ORF Clone
RC219912L4

USD 1,720.00

3 Weeks

Lenti-ORF clone of PTPRM (mGFP-tagged)-Human protein tyrosine phosphatase, receptor type, M (PTPRM), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RPTP mu (PTPRM) (NM_002845) Human Tagged ORF Clone Lentiviral Particle
RC219912L4V

USD 1,920.00

6 Weeks

Lenti ORF particles, PTPRM (mGFP-tagged)-Human protein tyrosine phosphatase, receptor type, M (PTPRM), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RPTP mu (PTPRM) (NM_001105244) Human Tagged ORF Clone
RC226398L3

USD 1,740.00

3 Weeks

Lenti-ORF clone of PTPRM (Myc-DDK-tagged)-Human protein tyrosine phosphatase, receptor type, M (PTPRM), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RPTP mu (PTPRM) (NM_001105244) Human Tagged ORF Clone Lentiviral Particle
RC226398L3V

USD 1,940.00

6 Weeks

Lenti ORF particles, PTPRM (Myc-DDK-tagged)-Human protein tyrosine phosphatase, receptor type, M (PTPRM), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RPTP mu (PTPRM) (NM_001105244) Human Tagged ORF Clone
RC226398L4

USD 1,740.00

3 Weeks

Lenti-ORF clone of PTPRM (mGFP-tagged)-Human protein tyrosine phosphatase, receptor type, M (PTPRM), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RPTP mu (PTPRM) (NM_001105244) Human Tagged ORF Clone Lentiviral Particle
RC226398L4V

USD 1,940.00

6 Weeks

Lenti ORF particles, PTPRM (mGFP-tagged)-Human protein tyrosine phosphatase, receptor type, M (PTPRM), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RPTP mu (PTPRM) (NM_002845) Human Untagged Clone
SC118369

USD 2,950.00

In Stock

PTPRM (untagged)-Human protein tyrosine phosphatase, receptor type, M (PTPRM), transcript variant 2

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
RPTP mu (PTPRM) (NM_001105244) Human Untagged Clone
SC317168

USD 1,100.00

In Stock

PTPRM (untagged)-Human protein tyrosine phosphatase, receptor type, M (PTPRM), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
RPTP mu (PTPRM) (NM_001105244) Human Over-expression Lysate
LC426233

USD 187.00

In Stock

PTPRM HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
RPTP mu (PTPRM) (NM_001105244) Human Over-expression Lysate
LY426233

USD 605.00

In Stock

Transient overexpression lysate of protein tyrosine phosphatase, receptor type, M (PTPRM), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
RPTP mu (PTPRM) Rabbit Polyclonal Antibody
TA317227

USD 425.00

5 Days

PTPRM Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Hamster, Horse, Human, Mouse, Rabbit, Rat
Conjugation Unconjugated
Immunogen PTPRM / PTP Mu antibody was raised against synthetic 18 amino acid peptide from internal region of human PTPRM. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Mouse, Rat, Hamster, Panda, Horse, Rabbit, Opossum (100%); Marmoset, Bovine, Bat (94%).
RPTP mu (PTPRM) Rabbit Polyclonal Antibody
TA341072

USD 425.00

5 Days

Rabbit Polyclonal Anti-PTPRM Antibody (Internal)

Applications IHC
Reactivities Human
Immunogen PTPRM / PTP Mu antibody was raised against synthetic 16 amino acid peptide from internal region of human PTPRM. Percent identity with other species by BLAST analysis: Human, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Bovine, Bat, Horse, Rabbit (100%); Opossum, Chicken (94%); Elephant, Panda, Dog (88%); Gorilla, Xenopus (81%).
RPTP mu (PTPRM) Rabbit Polyclonal Antibody
TA341078

USD 425.00

5 Days

Rabbit Polyclonal Anti-PTPRM Antibody (Internal)

Applications IHC
Reactivities Human
Immunogen PTPRM / PTP Mu antibody was raised against synthetic 15 amino acid peptide from internal region of human PTPRM. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Rat, Hamster, Panda, Dog, Bat, Horse, Rabbit, Opossum (100%); Mouse, Elephant, Bovine, Xenopus (93%); Chicken (87%).
RPTP mu (PTPRM) Rabbit Polyclonal Antibody
TA343316

USD 375.00

5 Days

Rabbit Polyclonal Anti-PTPRM Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PTPRM antibody is: synthetic peptide directed towards the middle region of Human PTPRM. Synthetic peptide located within the following region: QQFQFLGWPMYRDTPVSKRSFLKLIRQVDKWQEEYNGGEGRTVVHCLNGG
RPTP mu (PTPRM) Rabbit Polyclonal Antibody
TA322946

USD 345.00

In Stock

Anti-PTPRM Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1370-1385 amino acids of Human protein tyrosine phosphatase, receptor type, M
RPTP mu (PTPRM) Rabbit Polyclonal Antibody
TA322947

USD 345.00

In Stock

Anti-PTPRM Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1370-1385 amino acids of Human protein tyrosine phosphatase, receptor type, M
RPTP mu (PTPRM) ICC Control Block
TB419912

USD 2,170.00

4 Weeks

Transient overexpression of PTPRM (NM_002845) in HEK293T cells paraffin embedded controls for ICC/IHC staining

RPTP mu (PTPRM) ICC Control Block
TB426398

USD 2,190.00

4 Weeks

Transient overexpression of PTPRM (NM_001105244) in HEK293T cells paraffin embedded controls for ICC/IHC staining

RPTP mu (PTPRM) ICC Control Sections
TS419912P5

USD 889.00

4 Weeks

Transient overexpression of PTPRM (NM_002845) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

RPTP mu (PTPRM) Cytosection
TS426398

USD 225.00

4 Weeks

Transient overexpression of PTPRM (NM_001105244) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

RPTP mu (PTPRM) Cytosection
TS426398P5

USD 889.00

4 Weeks

Transient overexpression of PTPRM (NM_001105244) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack