Lenti ORF particles, USP39 (mGFP-tagged) - Human ubiquitin specific peptidase 39 (USP39), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, USP39 (mGFP-tagged) - Human ubiquitin specific peptidase 39 (USP39), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USP39 (Myc-DDK-tagged)-Human ubiquitin specific peptidase 39 (USP39)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human ubiquitin specific peptidase 39 (USP39)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, USP39 (Myc-DDK tagged) - Human ubiquitin specific peptidase 39 (USP39), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, USP39 (mGFP-tagged) - Human ubiquitin specific peptidase 39 (USP39), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
USP39 (Myc-DDK tagged) - Homo sapiens ubiquitin specific peptidase 39 (USP39), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USP39 (GFP-tagged) - Human ubiquitin specific peptidase 39 (USP39)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human ubiquitin specific peptidase 39 (USP39), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, USP39 (Myc-DDK tagged) - Human ubiquitin specific peptidase 39 (USP39), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human ubiquitin specific peptidase 39 (USP39), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USP39 (Myc-DDK tagged) - Homo sapiens ubiquitin specific peptidase 39 (USP39), transcript variant 5
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USP39 (Myc-DDK tagged) - Homo sapiens ubiquitin specific peptidase 39 (USP39), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USP39 (Myc-DDK tagged) - Homo sapiens ubiquitin specific peptidase 39 (USP39), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USP39 (GFP-tagged) - Homo sapiens ubiquitin specific peptidase 39 (USP39), transcript variant 5
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
USP39 (GFP-tagged) - Homo sapiens ubiquitin specific peptidase 39 (USP39), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
USP39 (GFP-tagged) - Homo sapiens ubiquitin specific peptidase 39 (USP39), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
USP39 (GFP-tagged) - Homo sapiens ubiquitin specific peptidase 39 (USP39), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human ubiquitin specific peptidase 39 (USP39), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-USP39 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-USP39 antibody: synthetic peptide directed towards the N terminal of human USP39. Synthetic peptide located within the following region: MSGRSKRESRGSTRGKRESESRGSSGRVKRERDREREPEAASSRGSPVRV |
USP39 (untagged)-Human ubiquitin specific peptidase 39 (USP39)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
USP39 (untagged)-Human ubiquitin specific peptidase 39 (USP39)
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-USP39 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-USP39 antibody is: synthetic peptide directed towards the C-terminal region of Human USP39. Synthetic peptide located within the following region: YRIHVLHHGTGKWYELQDLQVTDILPQMITLSEAYIQIWKRRDNDETNQQ |
Transient overexpression lysate of ubiquitin specific peptidase 39 (USP39)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human ubiquitin specific peptidase 39 (USP39), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
USP39 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
USP39 MS Standard C13 and N15-labeled recombinant protein (NP_006581)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
USP39 (untagged) - Homo sapiens ubiquitin specific peptidase 39 (USP39), transcript variant 4
Vector | pCMV6 series |
Tag | Tag Free |
USP39 (untagged) - Homo sapiens ubiquitin specific peptidase 39 (USP39), transcript variant 5
Vector | pCMV6 series |
Tag | Tag Free |
USP39 (untagged) - Homo sapiens ubiquitin specific peptidase 39 (USP39), transcript variant 2
Vector | pCMV6 series |
Tag | Tag Free |
USP39 (untagged) - Homo sapiens ubiquitin specific peptidase 39 (USP39), transcript variant 3
Vector | pCMV6 series |
Tag | Tag Free |
Rabbit Polyclonal Anti-USP39 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human USP39 |
Transient overexpression of USP39 (NM_006590) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of USP39 (NM_001256728) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of USP39 (NM_001256727) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of USP39 (NM_001256726) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of USP39 (NM_001256725) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of USP39 (NM_006590) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of USP39 (NM_006590) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of USP39 (NM_001256728) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of USP39 (NM_001256727) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of USP39 (NM_001256726) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of USP39 (NM_001256725) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of USP39 (NM_001256725) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack