Products

Antibodies (56)
cDNA Clones (38)
Proteins (25)
Jump to Filters
View as table Download
GFPT2 (NM_005110) Human Tagged ORF Clone
RC200519

USD 98.00

USD 560.00

In Stock

GFPT2 (Myc-DDK-tagged)-Human glutamine-fructose-6-phosphate transaminase 2 (GFPT2)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
GFPT2 (NM_005110) Human Tagged ORF Clone Lentiviral Particle
RC200519L1V

USD 1,010.00

3 Weeks

Lenti ORF particles, GFPT2 (Myc-DDK tagged) - Human glutamine-fructose-6-phosphate transaminase 2 (GFPT2), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
GFPT2 (NM_005110) Human Tagged ORF Clone Lentiviral Particle
RC200519L2V

USD 1,010.00

6 Weeks

Lenti ORF particles, GFPT2 (mGFP-tagged) - Human glutamine-fructose-6-phosphate transaminase 2 (GFPT2), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
GFPT1 (NM_002056) Human Tagged ORF Clone Lentiviral Particle
RC207225L1V

USD 930.00

3 Weeks

Lenti ORF particles, Myc-DDK-tagged ORF particles, Homo sapiens glutamine--fructose-6-phosphate transaminase 1 (GFPT1) as transfection-ready DNA, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
GFPT1 (NM_002056) Human Tagged ORF Clone Lentiviral Particle
RC207225L2V

USD 930.00

In Stock

Lenti ORF particles, mGFP-tagged ORF particles, Homo sapiens glutamine--fructose-6-phosphate transaminase 1 (GFPT1) as transfection-ready DNA, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
GFPT1 (NM_002056) Human Untagged Clone
SC118874

USD 310.00

In Stock

GFPT1 (untagged)-Human glutamine--fructose-6-phosphate transaminase 1 (GFPT1)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
GFPT1 (NM_002056) Human Tagged ORF Clone
RC207225

USD 530.00

In Stock

Myc-DDK-tagged ORF clone of Homo sapiens glutamine--fructose-6-phosphate transaminase 1 (GFPT1) as transfection-ready DNA

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
GFPT2 (NM_005110) Human Tagged ORF Clone
RG200519

USD 670.00

In Stock

GFPT2 (GFP-tagged) - Human glutamine-fructose-6-phosphate transaminase 2 (GFPT2)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Phosphoribosyl pyrophosphate amidotransferase (PPAT) (NM_002703) Human Tagged ORF Clone Lentiviral Particle
RC201144L3V

USD 880.00

3 Weeks

Lenti ORF particles, PPAT (Myc-DDK tagged) - Human phosphoribosyl pyrophosphate amidotransferase (PPAT), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GFPT2 (NM_005110) Human Tagged ORF Clone
RC200519L3

USD 810.00

3 Weeks

Lenti ORF clone of Human glutamine-fructose-6-phosphate transaminase 2 (GFPT2), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GFPT2 (NM_005110) Human Tagged ORF Clone Lentiviral Particle
RC200519L3V

USD 1,010.00

5 Weeks

Lenti ORF particles, GFPT2 (Myc-DDK tagged) - Human glutamine-fructose-6-phosphate transaminase 2 (GFPT2), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GFPT2 (NM_005110) Human Tagged ORF Clone
RC200519L4

USD 810.00

3 Weeks

Lenti ORF clone of Human glutamine-fructose-6-phosphate transaminase 2 (GFPT2), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GFPT2 (NM_005110) Human Tagged ORF Clone Lentiviral Particle
RC200519L4V

USD 1,010.00

7 Weeks

Lenti ORF particles, GFPT2 (mGFP-tagged) - Human glutamine-fructose-6-phosphate transaminase 2 (GFPT2), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Phosphoribosyl pyrophosphate amidotransferase (PPAT) (NM_002703) Human Tagged ORF Clone Lentiviral Particle
RC201144L4V

USD 880.00

7 Weeks

Lenti ORF particles, PPAT (mGFP-tagged) - Human phosphoribosyl pyrophosphate amidotransferase (PPAT), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GFPT1 (NM_002056) Human Tagged ORF Clone
RC207225L3

USD 730.00

3 Weeks

Lenti-ORF clone of Myc-DDK-tagged ORF clone of Homo sapiens glutamine--fructose-6-phosphate transaminase 1 (GFPT1) as transfection-ready DNA

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GFPT1 (NM_002056) Human Tagged ORF Clone Lentiviral Particle
RC207225L3V

USD 930.00

6 Weeks

Lenti ORF particles, Myc-DDK-tagged ORF particles, Homo sapiens glutamine--fructose-6-phosphate transaminase 1 (GFPT1) as transfection-ready DNA, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GFPT1 (NM_002056) Human Tagged ORF Clone
RC207225L4

USD 730.00

3 Weeks

Lenti-ORF clone of mGFP-tagged ORF clone of Homo sapiens glutamine--fructose-6-phosphate transaminase 1 (GFPT1) as transfection-ready DNA

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GFPT1 (NM_002056) Human Tagged ORF Clone Lentiviral Particle
RC207225L4V

USD 930.00

11 Weeks

Lenti ORF particles, mGFP-tagged ORF particles, Homo sapiens glutamine--fructose-6-phosphate transaminase 1 (GFPT1) as transfection-ready DNA, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GFPT1 (NM_001244710) Human Tagged ORF Clone
RC234739

USD 610.00

5 Weeks

GFPT1 (Myc-DDK tagged) - Homo sapiens glutamine--fructose-6-phosphate transaminase 1 (GFPT1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
GFPT1 (NM_002056) Human Tagged ORF Clone
RG207225

USD 580.00

3 Weeks

GFPT1 (GFP-tagged) - Human glutamine--fructose-6-phosphate transaminase 1 (GFPT1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GFPT1 (NM_001244710) Human Tagged ORF Clone
RG234739

USD 670.00

5 Weeks

GFPT1 (GFP-tagged) - Homo sapiens glutamine--fructose-6-phosphate transaminase 1 (GFPT1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GFPT1 (NM_002056) Human Tagged Lenti ORF Clone
RC207225L2

USD 900.00

In Stock

Lenti-ORF clone of mGFP-tagged ORF clone of Homo sapiens glutamine--fructose-6-phosphate transaminase 1 (GFPT1) as transfection-ready DNA

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
GFPT2 (NM_005110) Human Tagged ORF Clone
RC200519L1

USD 1,008.00

In Stock

Lenti ORF clone of Human glutamine-fructose-6-phosphate transaminase 2 (GFPT2), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
GFPT1 (NM_002056) Human Tagged Lenti ORF Clone
RC207225L1

USD 900.00

In Stock

Lenti-ORF clone of Myc-DDK-tagged ORF clone of Homo sapiens glutamine--fructose-6-phosphate transaminase 1 (GFPT1) as transfection-ready DNA

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
GFPT2 (NM_005110) Human Untagged Clone
SC321384

USD 310.00

In Stock

GFPT2 (untagged)-Human glutamine-fructose-6-phosphate transaminase 2 (GFPT2)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
GFPT2 (NM_005110) Human Over-expression Lysate
LY417501

USD 396.00

In Stock

Transient overexpression lysate of glutamine-fructose-6-phosphate transaminase 2 (GFPT2)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Phosphoribosyl pyrophosphate amidotransferase (PPAT) (NM_002703) Human Tagged ORF Clone
RC201144L1

USD 840.00

In Stock

Lenti ORF clone of Human phosphoribosyl pyrophosphate amidotransferase (PPAT), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
GFPT2 Rabbit Polyclonal Antibody
TA346394

USD 475.00

5 Days

Rabbit Polyclonal Anti-GFPT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GFPT2 antibody: synthetic peptide directed towards the N terminal of human GFPT2. Synthetic peptide located within the following region: DLRKFLESKGYEFESETDTETIAKLIKYVFDNRETEDITFSTLVERVIQQ
GFPT2 Rabbit Polyclonal Antibody
TA346395

USD 475.00

5 Days

Rabbit Polyclonal Anti-GFPT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GFPT2 antibody: synthetic peptide directed towards the middle region of human GFPT2. Synthetic peptide located within the following region: TARQGRPIILCSKDDTESSKFAYKTIELPHTVDCLQGILSVIPLQLLSFH
GFPT2 (Center) Rabbit Polyclonal Antibody
AP51823PU-N

USD 450.00

2 Weeks

GFPT2 (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 181~210 amino acids from the Center region of human GFPT2 / GFAT2
GFPT1 (NM_002056) Human Over-expression Lysate
LY419564

USD 396.00

In Stock

Transient overexpression lysate of glutamine-fructose-6-phosphate transaminase 1 (GFPT1)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GFPT2 (NM_005110) Human Tagged ORF Clone
RC200519L2

USD 810.00

3 Weeks

Lenti ORF clone of Human glutamine-fructose-6-phosphate transaminase 2 (GFPT2), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
GFPT1 (NM_002056) Human Over-expression Lysate
LC419564

USD 121.00

In Stock

GFPT1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GFPT1 Rabbit Polyclonal Antibody
TA341276

USD 425.00

2 Weeks

Rabbit Polyclonal Anti-GFPT1 Antibody (N-Terminus)

Applications IHC
Reactivities Human
Immunogen GFPT1 / GFAT antibody was raised against synthetic 12 amino acid peptide from N-Terminus of human GFPT1. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Elephant, Panda, Bovine, Dog, Bat, Horse, Pig, Opossum, Guinea pig, Zebra finch, Chicken (100%); Turkey, Platypus (92%).
GFPT1 Rabbit Polyclonal Antibody
TA341277

USD 425.00

5 Days

Rabbit Polyclonal Anti-GFPT1 Antibody (C-Terminus)

Applications IHC
Reactivities Human
Immunogen GFPT1 / GFAT antibody was raised against synthetic 14 amino acid peptide from C-Terminus of human GFPT1. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Elephant, Bovine, Horse, Pig, Opossum, Guinea pig (100%); Dog, Bat (93%); Turkey, Zebra finch, Chicken (86%).
GFPT1 / GFAT1 (332-699, His-tag) Human Protein
AR51597PU-N

USD 845.00

2 Weeks

GFPT1 / GFAT1 (332-699, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli